(data stored in ACNUC7421 zone)

EMBL: AL009126.ECFAB

AL009126.ECFAB       Location/Qualifiers
FT   CDS_pept        151303..152133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfAB"
FT                   /locus_tag="BSU_01460"
FT                   /old_locus_tag="BSU01460"
FT                   /product="energizing coupling factor of ABC influx
FT                   transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12110480, 21135102, 26052893;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11922"
FT                   /db_xref="GOA:P70970"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="SubtiList:BG11989"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70970"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12110480, 21135102, 26052893"
FT                   /protein_id="CAB11922.1"
FT                   /translation="MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLK
FT                   PTKGQISLGSTVIQAGKKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVK
FT                   KEDAEQKAREMLQLVGLSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGL
FT                   DPRGRKEIMDMFYELHQRGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFL
FT                   KGEEMAGWGLDLPETIKFQRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL"
     atgaagaccc cgtttgagcg cctagcactg tatgatatca atgcatcgat taaagaagga        60
     agctacgtag ccgttatcgg gcatacaggc tctggcaagt ccactcttct acagcaccta       120
     aatggtctcc tgaagccgac gaagggacag atatcactag gcagcactgt cattcaggca       180
     gggaaaaaga ataaagatct gaaaaaactt cgtaaaaaag tcggaatcgt tttccaattt       240
     cctgagcatc aattattcga agaaacagtt cttaaagata tttcattcgg accgatgaac       300
     tttggtgtta aaaaagaaga tgctgaacaa aaagcgagag agatgctgca gcttgtaggt       360
     ttatcagaag agcttttgga caggtcaccc tttgaattaa gcgggggaca aatgcgcaga       420
     gttgcaattg ccggcgtact tgcaatggac cctgaagtgc ttgttctgga tgaaccgact       480
     gcaggattgg acccaagagg gcgaaaagag attatggaca tgttttatga gcttcatcaa       540
     cgtgggaact tgacgacgat ccttgtgaca cacagcatgg aggatgcagc tgcatacgct       600
     gatgaaatga ttgttatgca taaaggaacg atacaagcat caggcagtcc gcgtgatctg       660
     tttttaaagg gtgaagagat ggccggctgg gggctggatc ttcctgaaac aataaaattc       720
     caaagacacc ttgaagctgc actgggtgtg agatttaatg agcctatgct cacaatcgaa       780
     gatgccgctg ccgaaatccg tgctcttttt cagggagaga agactttatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page