(data stored in ACNUC7421 zone)

EMBL: AL009126.EESA

AL009126.EESA        Location/Qualifiers
FT   CDS_pept        complement(179595..180347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eesA"
FT                   /locus_tag="BSU_01600"
FT                   /old_locus_tag="BSU01600"
FT                   /product="iron-chelator (enterobactin family) esterase"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 2974033, 17725565,
FT                   22210890, 28283524; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01600"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11936"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="SubtiList:BG11565"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55192"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 2974033, 17725565, 22210890, 28283524"
FT                   /protein_id="CAB11936.2"
FT                   /translation="MKGSLSEHKAGNRRFTLYLPPSYSTDSGGFPAVYVQDGSSLFQNQ
FT                   IELLESAFQQQRLPELVLIGIEPENRLDEYTPWPAASLSDRFTDFGGMGYHYLSDITNQ
FT                   FIPLIEENWNVTREPQSRGMIGASLGGLISMFAILKYPSMFGKIGSISGSYWYENAAET
FT                   IHISSLKPGTARVFMSIGSEEGREKQSIQRHMLKKTKQVHQSLKEKGFTEDQLCLSIEK
FT                   GAVHHHKYFCKQFINALEWLYGKNRSTL"
     ttgaaaggat ctctttcaga acacaaagcc ggcaacagga ggttcacgct gtacctccct        60
     ccttcctaca gcacagacag cgggggattt cctgctgttt acgtgcagga tggcagttct       120
     ttgttccaaa accaaatcga attactagaa agcgcctttc aacagcaaag gctccctgaa       180
     ctcgtgctga tcggtatcga acccgaaaac cggcttgatg aatacacccc atggccggct       240
     gcatcactca gtgatcggtt cacggacttc ggcggaatgg gatatcacta tctgtctgat       300
     ataacgaacc agttcattcc gctaatcgaa gaaaactgga acgtcaccag ggaaccgcag       360
     tcaagaggaa tgatcggtgc ctcattaggc ggcctcatct caatgttcgc catattaaaa       420
     tatccgtcaa tgttcgggaa aataggctct atatcaggtt catactggta cgagaacgca       480
     gcggaaacca ttcatatatc ttctttaaag cccggcactg cacgtgtttt catgtctatc       540
     gggagtgaag aaggccgtga aaaacaatcc attcagcgac atatgctgaa aaaaacaaag       600
     caagttcatc aaagtctaaa agaaaaaggc ttcactgaag accagttgtg tctttcaatt       660
     gaaaaaggag cggtgcacca ccacaagtat ttctgcaaac agttcatcaa cgcgctcgaa       720
     tggctatacg gaaaaaaccg ctcaacccta tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page