(data stored in SCRATCH zone)

EMBL: AL009126.ESTA

AL009126.ESTA        Location/Qualifiers
FT   CDS_pept        292205..292843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estA"
FT                   /locus_tag="BSU_02700"
FT                   /old_locus_tag="BSU02700"
FT                   /product="secreted alkaliphilic lipase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="3.1.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8396026, 15812018, 18053819,
FT                   11029590, 24827611, 28963005; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12064"
FT                   /db_xref="GOA:P37957"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1I6W"
FT                   /db_xref="PDB:1ISP"
FT                   /db_xref="PDB:1R4Z"
FT                   /db_xref="PDB:1R50"
FT                   /db_xref="PDB:1T2N"
FT                   /db_xref="PDB:1T4M"
FT                   /db_xref="PDB:2QXT"
FT                   /db_xref="PDB:2QXU"
FT                   /db_xref="PDB:3D2A"
FT                   /db_xref="PDB:3D2B"
FT                   /db_xref="PDB:3D2C"
FT                   /db_xref="PDB:3QMM"
FT                   /db_xref="PDB:3QZU"
FT                   /db_xref="PDB:5CRI"
FT                   /db_xref="PDB:5CT4"
FT                   /db_xref="PDB:5CT5"
FT                   /db_xref="PDB:5CT6"
FT                   /db_xref="PDB:5CT8"
FT                   /db_xref="PDB:5CT9"
FT                   /db_xref="PDB:5CTA"
FT                   /db_xref="PDB:5CUR"
FT                   /db_xref="SubtiList:BG10679"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37957"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8396026, 15812018, 18053819, 11029590, 24827611,
FT                   28963005"
FT                   /protein_id="CAB12064.1"
FT                   /translation="MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEHNPVVMVHGIGG
FT                   ASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDI
FT                   VAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSA
FT                   DMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN"
     atgaaatttg taaaaagaag gatcattgca cttgtaacaa ttttgatgct gtctgttaca        60
     tcgctgtttg cgttgcagcc gtcagcaaaa gccgctgaac acaatccagt cgttatggtt       120
     cacggtattg gaggggcatc attcaatttt gcgggaatta agagctatct cgtatctcag       180
     ggctggtcgc gggacaagct gtatgcagtt gatttttggg acaagacagg cacaaattat       240
     aacaatggac cggtattatc acgatttgtg caaaaggttt tagatgaaac gggtgcgaaa       300
     aaagtggata ttgtcgctca cagcatgggg ggcgcgaaca cactttacta cataaaaaat       360
     ctggacggcg gaaataaagt tgcaaacgtc gtgacgcttg gcggcgcgaa ccgtttgacg       420
     acaggcaagg cgcttccggg aacagatcca aatcaaaaga ttttatacac atccatttac       480
     agcagtgccg atatgattgt catgaattac ttatcaagat tagatggtgc tagaaacgtt       540
     caaatccatg gcgttggaca catcggcctt ctgtacagca gccaagtcaa cagcctgatt       600
     aaagaagggc tgaacggcgg gggccagaat acgaattaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page