(data stored in SCRATCH zone)

EMBL: AL009126.FEUC

AL009126.FEUC        Location/Qualifiers
FT   CDS_pept        complement(180344..181354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuC"
FT                   /locus_tag="BSU_01610"
FT                   /old_locus_tag="BSU01610"
FT                   /product="iron-uptake protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 2651410, 15849754, 16850406,
FT                   27375568; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01610"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11937"
FT                   /db_xref="GOA:P40411"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="SubtiList:BG10837"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40411"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11937.2"
FT                   /translation="MAKKYALFIALILVVSYFSLTSGSFSVRPAELLSTLFQIDPNPQY
FT                   EILLFDLRLPRVVMAAIIGLGLGIAGAVIQAITRNGLADPGILGINAGAGAGIVAFMLL
FT                   FQGQKEVTSIAAAMGMPLFGLIGGLIAAILIYIFAWHRGNLDSGRIILVGIAINSGFSA
FT                   LSLFLSLKMDPQDYQMAMVWKNGSIWSANWTYITAVLPWMLLFIPILIGKSRLLDTIRF
FT                   DEDTVRSLGISSNKEKTILLVACVAIISACVSVAGSMAFVGLIAPHISRRLAGVEHRYI
FT                   LPLSGLIGMLLVISADFAGKLFFQPAEVPAGIILAILGVPYFLYLLFKQKKGENA"
     atggctaaaa aatatgcatt gttcatcgct ttgattcttg ttgtcagcta tttcagctta        60
     acgagcggat cattttctgt tcgtcctgct gagctgctct ccactctttt tcaaatcgac       120
     ccgaatccgc agtatgaaat tttgctgttc gatttaagac tgccgcgggt tgtcatggct       180
     gctattattg gactcggtct tggcattgca ggcgctgtta tccaggccat cacgagaaac       240
     gggcttgctg accctggaat tctcggaatc aacgcagggg caggagctgg cattgtagcg       300
     tttatgctct tattccaagg ccagaaggaa gtgacatcca tagctgcagc gatgggaatg       360
     ccgctctttg gattgatagg cgggctcatc gcggcgatcc tgatttacat atttgcatgg       420
     cacagaggca atttagattc aggaagaatt attttggtag ggattgcgat caattcagga       480
     ttcagcgccc tgtctttgtt tttatcttta aaaatggacc cgcaagacta tcaaatggcc       540
     atggtgtgga aaaacggaag catctggtct gccaactgga cgtatattac agctgtactc       600
     ccatggatgc tgctgtttat accgattctt atcggcaaat cccgcctgct cgacaccatt       660
     cgttttgatg aagacacagt cagaagcctc ggtatttcat caaataaaga aaaaaccatc       720
     cttctcgttg cctgtgtagc aatcatcagc gcctgtgtct ccgtagcggg aagtatggcg       780
     tttgtcggct taattgctcc ccatatctca cggagactgg ctggcgtcga acatcgctat       840
     atcctgccac tgagcggttt aatcgggatg cttcttgtga taagcgcaga ctttgccgga       900
     aaactgtttt ttcagcccgc agaagtgccc gcaggcatca ttttggcgat cctcggagtt       960
     ccttatttct tatatctgct tttcaagcaa aaaaaggggg agaatgcttg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page