(data stored in ACNUC7421 zone)

EMBL: AL009126.FFOR

AL009126.FFOR        Location/Qualifiers
FT   CDS_pept        352858..353868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffoR"
FT                   /locus_tag="BSU_03270"
FT                   /old_locus_tag="BSU03270"
FT                   /product="Fur-regulated NADPH:ferredoxin oxidoreductase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.8.1.-"
FT                   /EC_number="1.18.1.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16672620, 25826316; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12121"
FT                   /db_xref="GOA:O31475"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="PDB:5XHU"
FT                   /db_xref="SubtiList:BG12018"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31475"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16672620, 25826316"
FT                   /protein_id="CAB12121.1"
FT                   /translation="MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGK
FT                   VSLFFPEKIIRDIGGIPGIAGKQLIEQLKEQAATFDPDIVLNQRVTGFERLDDGTIVLT
FT                   GSEGKKHYTRTVILACGMGTLEVNEFDSEDAARYAGKNLHYGVEKLDAFKGKRVVISGG
FT                   GDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEG
FT                   IKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWGLEIEEGRVKADRHMRTNLPG
FT                   VFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK"
     atggctgaga atcaagaggt atatgacgtt acgattatag gcggggggcc gatcgggctg        60
     tttactgctt tttactgcgg gatgcgggag ctgaaaacaa aggtaatcga atttttgccg       120
     aagctcggag ggaaggtgtc tttattcttt cctgagaaaa tcattcgcga tatcggcggc       180
     ataccgggga ttgcgggaaa gcagctgatc gagcagctga aggagcaggc ggcaacgttt       240
     gatcctgata tcgtattgaa tcagcgtgtg accgggtttg aacgcctaga tgacggcacc       300
     attgttctga cgggttctga agggaaaaag cactatacaa gaactgtgat tttggcttgc       360
     ggcatgggta cacttgaggt caatgagttt gacagcgagg atgcggcccg atatgcgggc       420
     aaaaatcttc attatggagt ggagaagctc gatgcgttta aagggaaacg cgtggtgata       480
     tcaggcggcg gagatactgc ggtcgattgg gctaatgagc ttgaaccgat tgcggcgtct       540
     gtgactgtcg ttcatcggcg tgaggaattc ggcggaatgg aaagcagcgt gacgaaaatg       600
     aagcaatcat cggtgcgggt gcttacgcct tatcggctgg agcagttgaa cggagatgaa       660
     gagggcatca aaagcgtgac cgtttgtcat actgagtctg gccagaggaa agacatagaa       720
     attgatgagc tgatcattaa tcatgggttc aaaattgatc tcgggccgat gatggagtgg       780
     gggctggaga ttgaagaagg aagggtgaaa gctgacagac atatgcgaac gaatcttccg       840
     ggcgtgtttg tggcgggcga cgcggctttt tatgaaagca agctgagatt gattgccggc       900
     ggatttacgg aaggcccgac agcggtcaac agtgccaagg cttatctgga ccctaaggcc       960
     gagaatatgg cgatgtattc cacccatcat aaaaaattgg tgcataaata a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page