(data stored in ACNUC7421 zone)

EMBL: AL009126.FIN

AL009126.FIN         Location/Qualifiers
FT   CDS_pept        60130..60360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fin"
FT                   /locus_tag="BSU_00540"
FT                   /old_locus_tag="BSU00540"
FT                   /product="protein required for the switch from F to G
FT                   during sporulation (anti sigma F)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 21037003, 28598017; Product
FT                   type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00540"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11830"
FT                   /db_xref="GOA:P37553"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="PDB:5MSL"
FT                   /db_xref="SubtiList:BG10117"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37553"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:21037003, 28598017"
FT                   /protein_id="CAB11830.1"
FT                   /translation="MALHYYCRHCGVKVGSLESSMVSTDSLGFQHLTNEERNDMISYKE
FT                   NGDVHVLTICEDCQEALDRNPHYHEYHTFIQ"
     atggctttgc attattattg tcgtcattgc ggagtgaaag taggcagtct cgaatcttca        60
     atggtatcga cagactcact tggatttcag cacttaacaa atgaggaaag aaacgatatg       120
     atttcttata aagaaaatgg agatgtccat gttttgacga tatgtgaaga ctgccaagag       180
     gcgcttgacc gaaatccgca ttaccacgaa tatcacacat ttattcaata a                231
//

If you have problems or comments...

PBIL Back to PBIL home page