(data stored in ACNUC7421 zone)

EMBL: AL009126.FOLB

AL009126.FOLB        Location/Qualifiers
FT   CDS_pept        86587..86949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BSU_00780"
FT                   /old_locus_tag="BSU00780"
FT                   /product="dihydroneopterin aldolase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16188473, 17176045, 17388809;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11854"
FT                   /db_xref="GOA:P28823"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="SubtiList:BG10141"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28823"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11854.1"
FT                   /translation="MDKVYVEGMEFYGYHGVFTEENKLGQRFKVDLTAELDLSKAGQTD
FT                   DLEQTINYAELYHVCKDIVEGEPVKLVETLAERIAGTVLGKFQPVQQCTVKVIKPDPPI
FT                   PGHYKSVAIEITRKKS"
     atggataaag tttatgtaga aggtatggag ttttacggat atcacggtgt gttcacagaa        60
     gaaaacaaac ttggccagcg gtttaaagtc gatttaaccg ctgagctgga tttaagcaaa       120
     gctggacaga cagacgacct tgagcaaacg atcaactatg ctgagctcta tcacgtatgt       180
     aaagatatcg tggaagggga gcctgtgaaa ttggtggaaa cgctggcgga acgtattgct       240
     ggcactgttc tcggaaaatt tcagcctgtt cagcaatgta cggtgaaagt gattaagcca       300
     gacccgccaa ttcccggaca ctataaatca gtagcaattg aaattacgag aaaaaagtca       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page