(data stored in SCRATCH zone)

EMBL: AL009126.FOLEB

AL009126.FOLEB       Location/Qualifiers
FT   CDS_pept        364259..365173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folEB"
FT                   /locus_tag="BSU_03340"
FT                   /old_locus_tag="BSU03340"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.4.16"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12426338, 17032654, 19767425;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12128"
FT                   /db_xref="GOA:P94398"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="SubtiList:BG12019"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94398"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12426338, 17032654, 19767425"
FT                   /protein_id="CAB12128.2"
FT                   /translation="MNQHTLLPKKTERLQYFGSVSPIKGEKPVEKEKMKDLQNIRKDYF
FT                   FDIQHVGVANVSHPVTITSAMMPAEQTTAANFTMTCNLPRNQKGINMSRLTELLQVYHQ
FT                   NGWILSFSSLQQFTKELAENMDTSSATVEVRFPWFFERKSPKLEKAGLMHADIFMSVTY
FT                   RKDQPFKQRAGISAKVTTLCPCSKEISEYSAHNQRGTVSIWADIHPAASLPSDVKADLL
FT                   HAAESNASARLHPVLKRPDEKAVTETAYENPRFVEDLARLIAADLFELEWVSAFEIECR
FT                   NEESIHLHDAYAKLCFSKEVDKI"
     atgaatcaac atacgctgct cccgaaaaaa acggagcgtc ttcaatactt tggatcggtc        60
     agtccgatca aaggcgagaa accagtggaa aaagagaaaa tgaaggacct gcaaaatatc       120
     aggaaggatt atttttttga cattcagcat gtaggtgtag ctaatgtgtc ccatccagtc       180
     acaatcactt ctgccatgat gcctgccgag caaacaacgg ctgcgaactt tacaatgact       240
     tgtaatttgc cgagaaatca gaaggggatt aacatgagcc ggttaacaga gctgctgcaa       300
     gtctatcatc aaaatggctg gattctctca ttttcctctc ttcagcaatt tacgaaagag       360
     cttgcagaaa acatggacac atcatctgcc acagttgaag tgaggtttcc gtggtttttc       420
     gaacggaaaa gcccgaagct tgagaaagcg ggtttgatgc atgctgatat attcatgtct       480
     gtcacctatc gcaaagatca gccgtttaaa cagcgtgccg gcatctcagc aaaagtaacg       540
     actctgtgcc cttgctccaa ggaaatcagc gaatacagtg cccataatca gaggggaacg       600
     gtcagcattt gggcggatat tcacccggcc gcatcgctgc caagtgatgt taaagctgat       660
     ttgcttcacg ccgcagaatc aaatgcttct gcgagactgc atccggtatt gaagcggcct       720
     gatgaaaaag ccgtgacaga aacggcctat gaaaacccga gatttgttga ggatctcgcc       780
     cggctgattg ctgcagattt gtttgagctt gaatgggtgt cagcctttga gattgaatgc       840
     cgaaatgaag aatcgatcca tcttcacgat gcctatgcga agctgtgttt ttcgaaggaa       900
     gtggataaaa tatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page