(data stored in SCRATCH zone)

EMBL: AL009126.FOLK

AL009126.FOLK        Location/Qualifiers
FT   CDS_pept        86946..87449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BSU_00790"
FT                   /old_locus_tag="BSU00790"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.6.3"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 17029412; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00790"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11855"
FT                   /db_xref="GOA:P29252"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="SubtiList:BG10142"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29252"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11855.1"
FT                   /translation="MNNIAYIALGSNIGDRETYLRQAVALLHQHAAVTVTKVSSIYETD
FT                   PVGYEDQAQFLNMAVEIKTSLNPFELLELTQQIENELGRTREVRWGPRTADLDILLFNR
FT                   ENIETEQLIVPHPRMYERLFVLAPLAEICQQVEKEATSAETDQEGVRVWKQKSGVDEFV
FT                   HSES"
     atgaacaaca tagcttatat tgcacttgga tctaatattg gagatagaga aacgtattta        60
     aggcaagcag tggctttact gcatcagcat gctgcggtga cagtcactaa agtgtcgtct       120
     atttacgaaa ctgacccggt cggatacgaa gatcaagctc aatttttgaa tatggctgtt       180
     gaaatcaaga catcattgaa cccttttgaa ctccttgaac tgacgcagca gatagaaaat       240
     gaattaggca gaacaaggga agtaagatgg gggccgcgga cggcagacct tgacattttg       300
     ttatttaatc gtgaaaatat tgaaacagag caactaattg ttccgcatcc gagaatgtat       360
     gagcgtttgt ttgtccttgc gccgcttgcg gaaatttgcc agcaggttga aaaagaggct       420
     acaagcgccg aaacagacca agaaggtgta agagtatgga agcagaaatc tggggtagac       480
     gaattcgtgc attcagaaag ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page