(data stored in SCRATCH zone)

EMBL: AL009126.FOLP

AL009126.FOLP        Location/Qualifiers
FT   CDS_pept        85737..86594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BSU_00770"
FT                   /old_locus_tag="BSU00770"
FT                   /product="dihydropteroate synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.5.1.15"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2123867, 11007651; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11853"
FT                   /db_xref="GOA:P28822"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="SubtiList:BG10140"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28822"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11853.1"
FT                   /translation="MAQHTIDQTQVIHTKPSALSYKEKTLVMGILNVTPDSFSDGGKYD
FT                   SLDKALLHAKEMIDDGAHIIDIGGESTRPGAECVSEDEEMSRVIPVIERITKELGVPIS
FT                   VDTYKASVADEAVKAGASIINDIWGAKHDPKMASVAAEHNVPIVLMHNRPERNYNDLLP
FT                   DMLSDLMESVKIAVEAGVDEKNIILDPGIGFAKTYHDNLAVMNKLEIFSGLGYPVLLAT
FT                   SRKRFIGRVLDLPPEERAEGTGATVCLGIQKGCDIVRVHDVKQIARMAKMMDAMLNKGG
FT                   VHHG"
     atggcgcagc acacaataga tcaaacacaa gtaatccaca ctaagcccag cgctttatca        60
     tataaagaga agacgctggt gatgggaatt ttaaacgtaa cgcctgactc tttctcggac       120
     ggcggaaaat atgacagctt ggacaaggcg ctgctgcacg cgaaagagat gatcgatgat       180
     ggtgcccata tcattgatat tggaggggaa tcgacaaggc ctggcgctga gtgcgtatct       240
     gaggatgagg agatgtccag agtcattccg gtgattgagc ggattacgaa agagcttggt       300
     gttcctattt ctgtagacac gtacaaggct tctgtcgcag atgaagcagt gaaagccggt       360
     gcatccatta tcaatgatat ttggggagcc aaacatgatc cgaagatggc ttccgttgca       420
     gctgaacata atgttccaat tgtactcatg cataaccgcc ctgaaagaaa ctacaatgac       480
     ttattgccgg atatgctgtc ggacttaatg gagagtgtaa aaattgctgt tgaggccgga       540
     gtagacgaga agaacattat tcttgatcct ggtatcggtt tcgcgaaaac ctatcacgat       600
     aacttggcag tgatgaacaa actagagatt ttcagcggat tgggatatcc ggttcttctg       660
     gcaacctccc gaaaaagatt catcggacgt gttctggatc ttccgcctga ggagcgggct       720
     gagggcacag gcgcgactgt gtgtctcggc attcaaaaag gctgtgacat tgtcagggtc       780
     catgatgtaa agcaaattgc cagaatggcg aaaatgatgg acgcgatgct gaataaggga       840
     ggggtgcacc atggataa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page