(data stored in SCRATCH zone)

EMBL: AL009126.FTSH

AL009126.FTSH        Location/Qualifiers
FT   CDS_pept        76984..78897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BSU_00690"
FT                   /old_locus_tag="BSU00690"
FT                   /product="ATP-dependent cytoplasmic membrane protease"
FT                   /function="16.13: Shape"
FT                   /function="16.9: Replicate"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9076729, 9084181, 9287010,
FT                   9352926, 10851010, 10913836, 12533473, 24001521, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00690"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11845"
FT                   /db_xref="GOA:P37476"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="SubtiList:BG10132"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37476"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9076729, 9084181, 9287010, 9352926, 10851010,
FT                   10913836, 12533473, 24001521, 22720735"
FT                   /protein_id="CAB11845.1"
FT                   /translation="MNRVFRNTIFYLLILLVVIGVVSYFQTSNPKTENMSYSTFIKNLD
FT                   DGKVDSVSVQPVRGVYEVKGQLKNYDKDQYFLTHVPEGKGADQIFNALKKTDVKVEPAQ
FT                   ETSGWVTFLTTIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREAVL
FT                   KVHARNKPLDETVNLKSIAMRTPGFSGADLENLLNEAALVAARQNKKKIDARDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEGGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVML
FT                   PREDRYFQTKPELLDKIVGLLGGRVAEEIIFGEVSTGAHNDFQRATNIARRMVTEFGMS
FT                   EKLGPLQFGQSQGGQVFLGRDFNNEQNYSDQIAYEIDQEIQRIIKECYERAKQILTENR
FT                   DKLELIAQTLLKVETLDAEQIKHLIDHGTLPERNFSDDEKNDDVKVNILTKTEEKKDDT
FT                   KE"
     atgaatcggg tcttccgtaa taccattttt tatttactta ttttattagt agtaatcggg        60
     gttgtgagct acttccagac ctcaaatccg aaaacagaaa atatgtcgta cagtacgttc       120
     atcaaaaacc tggatgacgg gaaagttgat agcgtatcgg ttcagcctgt cagaggtgtt       180
     tatgaggtaa aagggcagct gaaaaactac gacaaagatc aatacttttt gactcatgtt       240
     cctgaaggaa agggagcaga ccagatattt aacgctttga aaaagacaga cgtaaaggtt       300
     gagcccgcgc aagaaacaag cggatgggtg acgttcctga cgaccatcat cccatttgtc       360
     attatcttta ttctgttttt cttcctgctc aatcaggctc aaggcggcgg cagccgtgtc       420
     atgaactttg gcaagagtaa agcgaagctg tatacagagg aaaagaaacg cgtcaaattt       480
     aaagacgttg caggggctga cgaagaaaag caagaacttg ttgaagttgt tgagtttctg       540
     aaagatcccc gcaagtttgc cgagctcggc gccagaatac cgaaaggcgt gcttttagtc       600
     ggacctccgg gtaccggtaa aacattgctt gccaaggctt gtgcaggaga agccggcgta       660
     cctttcttca gcatcagcgg atctgatttc gttgaaatgt ttgtaggggt cggtgcttcc       720
     cgtgtgcgtg acttgtttga aaatgcgaaa aagaatgcgc cttgtttgat cttcattgat       780
     gaaattgacg cagtcggacg ccagcgtggc gctggtctcg gcggtggaca cgatgaacgt       840
     gaacagacgc taaaccaatt gcttgttgaa atggacggat tcagcgctaa tgaaggaatt       900
     atcatcattg ctgcgacgaa ccgtgcggac atcttggacc cagccttact tcgtccggga       960
     cgttttgacc gtcaaatcac agtggaccgc ccagatgtca ttggccgtga agctgtattg      1020
     aaagtccatg cgagaaacaa accgctggat gaaacggtta acctaaaatc aattgccatg      1080
     agaacaccag gcttctcagg cgctgactta gaaaacctct tgaatgaagc tgcgcttgta      1140
     gcggctcgtc aaaacaagaa aaaaatcgat gcgcgtgata ttgacgaagc gacggaccgt      1200
     gtaattgccg gacccgctaa gaagagccgc gttatctcca agaaagaacg caatatcgtg      1260
     gcttatcacg aaggcggaca caccgttatc ggtctcgttt tagatgaggc agatatggtt      1320
     cataaagtaa cgattgttcc tcggggccag gctggcggtt atgctgttat gctgccaaga      1380
     gaagaccgtt atttccaaac aaagccggag ctgcttgata aaattgtcgg cctcttgggc      1440
     ggacgtgttg ctgaagagat tatcttcggt gaagtcagca caggggcgca caatgacttc      1500
     cagcgtgcga cgaatattgc aagacgaatg gttacagaat tcggtatgtc agaaaaactg      1560
     ggaccgttgc aatttggaca gtctcagggc ggtcaggtat tcttaggccg tgatttcaac      1620
     aacgaacaga actacagtga tcaaatcgct tacgaaattg atcaggaaat tcagcgcatc      1680
     atcaaagaat gttatgagcg tgcgaaacaa atcctgactg aaaatcgtga caagcttgaa      1740
     ttgattgccc aaacgcttct gaaagttgaa acgcttgacg ctgaacaaat caaacacctt      1800
     atcgatcatg gaacattacc tgagcgtaat ttctcagatg atgaaaagaa cgatgatgtg      1860
     aaagtaaaca ttctgacaaa aacagaagaa aagaaagacg atacgaaaga gtaa            1914
//

If you have problems or comments...

PBIL Back to PBIL home page