(data stored in ACNUC7421 zone)

EMBL: AL009126.FUSA

AL009126.FUSA        Location/Qualifiers
FT   CDS_pept        130684..132762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BSU_01120"
FT                   /old_locus_tag="BSU01120"
FT                   /product="elongation factor G"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 815236, 815243, 1556067,
FT                   4629789, 19366171, 22720735; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11888"
FT                   /db_xref="GOA:P80868"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="PDB:5VH6"
FT                   /db_xref="SubtiList:BG11939"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80868"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:815236, 815243, 1556067, 4629789, 19366171, 22720735"
FT                   /protein_id="CAB11888.2"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILFYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQ
FT                   LPIGAEDNFEGIIDLVENVAYFYEDDLGTRSDAKEIPEEYKEQAEELRNSLIEAVCELD
FT                   EELMDKYLEGEEITIDELKAGIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVAAIKGTRPDTNEEIERHSSDEEPFSALAFKVMTDPYVGKLTFFRVYSGTLDSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKDLVILES
FT                   MEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRTGAKVEGKFVRQSGGRGQFGHVWIEFEPNEE
FT                   GAGFEFENAIVGGVVPREYIPAVQAGLEDALENGVLAGFPLIDIKAKLFDGSYHDVDSN
FT                   EMAFKVAASMALKNAVSKCNPVLLEPIMKVEVVIPEEYMGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLAEMFGYATALRSNTQGRGTFTMHMDHYEEVPKSVAEEIIKKNKGE"
     atggcaagag agttctcctt agaaaaaact cgtaatatcg gtatcatggc tcacatcgat        60
     gccggtaaaa cgactactac agaacgtatc ttgttctata ctggtcgtat ccacaaaatt       120
     ggtgaaactc atgaaggagc ttcacaaatg gactggatgg agcaggaaca agaacgtggt       180
     atcacaatca cttccgctgc gactactgca cagtggaaag gataccgcgt aaacatcatc       240
     gatactccag gacacgtaga cttcacagtt gaagttgaac gttctcttcg tgtacttgat       300
     ggtgctgttg ctgtacttga cgcgcaatca ggcgttgagc ctcaaacaga aactgtttgg       360
     cgtcaggcaa caacttatgg agtaccgcgt atcgtttttg ttaacaaaat ggacaaaatc       420
     ggtgcagact tcctttactc tgtaggaact ttaagagacc gtcttcaagc aaacgctcat       480
     gcaattcaat tgccgatcgg tgctgaagat aacttcgaag gtatcattga ccttgtagaa       540
     aacgttgcgt atttctacga agatgacctc ggaactcgtt ctgatgcaaa agaaatccct       600
     gaagagtaca aagagcaagc tgaagagctt cgcaacagcc ttattgaagc tgtatgtgag       660
     cttgatgaag agcttatgga taagtacctt gagggtgaag aaatcacaat tgacgagtta       720
     aaagcaggaa ttcgtaaagg tacattaaat gttgaattct accctgttct tgttggttct       780
     gccttcaaaa acaaaggtgt tcaactagta cttgatgctg ttcttgacta ccttcctgca       840
     ccaactgacg ttgctgcaat caaaggtaca cgtcctgata caaatgaaga gattgagcgt       900
     cattcttctg acgaagagcc attctctgca ttagcattta aagttatgac tgacccttac       960
     gttggtaagt tgacgttctt ccgtgtgtac tctggaacac ttgattctgg ttcatacgtg      1020
     aaaaactcta ctaaaggcaa acgtgagcgt gttggacgta ttcttcaaat gcacgctaac      1080
     agccgtgaag aaatctctac tgtatacgca ggggatatcg cagctgctgt aggtctaaaa      1140
     gatacaacta ctggagatac tctatgtgat gagaaggatc ttgttatcct tgagtcaatg      1200
     gaattcccag aaccagttat cgacgttgct attgagccta aatcaaaagc tgaccaagat      1260
     aaaatgggta tcgctttagc gaaacttgct gaagaagatc ctacattccg tactcaaaca      1320
     aacccagaaa ctggccaaac gatcatctct ggtatgggtg aacttcacct tgatatcatt      1380
     gttgaccgta tgaaacgcga atttaaagta gaagccaatg ttggtgctcc tcaagttgcg      1440
     taccgtgaaa cattccgtac cggtgcaaaa gttgaaggta aattcgtacg tcagtctggt      1500
     ggacgcggtc agttcggaca cgtttggatc gaattcgaac caaacgaaga aggcgctggc      1560
     tttgaatttg aaaatgcgat tgtcggtggg gtcgttcctc gtgaatacat cccagctgtt      1620
     caagcaggtc tggaagatgc actcgaaaat ggtgtactag caggcttccc gcttatcgac      1680
     attaaagcta aacttttcga cggttcttac catgatgttg actcaaacga aatggcattt      1740
     aaagtcgctg cttctatggc attgaaaaat gcagtcagca aatgtaaccc agttcttctt      1800
     gaaccaatca tgaaagtgga agtggttatt ccagaagaat atatgggaga tatcatgggt      1860
     gatatcactt cacgtcgcgg acgcgtagaa ggtatggaag cacgcggtaa cgctcaagtt      1920
     gttcgtgcta tggttcctct tgctgaaatg ttcggttacg ctactgcact tcgttctaat      1980
     acgcaaggtc gcggtacgtt cactatgcac atggatcact acgaagaagt gccgaagagc      2040
     gtcgcagaag aaattatcaa aaaaaataaa ggcgaataa                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page