(data stored in SCRATCH zone)

EMBL: AL009126.GABD

AL009126.GABD        Location/Qualifiers
FT   CDS_pept        442950..444338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BSU_03910"
FT                   /old_locus_tag="BSU03910"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.2.1.24"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 15590624, 9723923,
FT                   12123465, 24529384, 24809290, 25911692; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12199"
FT                   /db_xref="GOA:P94428"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="SubtiList:BG12044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94428"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 15590624, 9723923, 12123465, 24529384,
FT                   24809290, 25911692"
FT                   /protein_id="CAB12199.1"
FT                   /translation="MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTS
FT                   ANERTSLLKKWYELIVEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVY
FT                   GRTVPAPTTGKRIVVTRQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTP
FT                   LSAYELARLAYEAGIPKDVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNS
FT                   ADTVKHVSMELGGHAPLIVDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDE
FT                   FAAKLSEQVSKLKVGNGLEEGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRN
FT                   DDKGCYFVNPTVLTDVDTSMNIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFF
FT                   TENYRRGIYISENLEYGIIGWNDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYL
FT                   SIGL"
     atgccagatc aattaacggt ctacaacccg gctacgggcg aggagatcaa aacgattcct        60
     cagcaatcag ccacagaggt agaagaagcc attgaacgtt cacatcaagc gtttaaaacg       120
     tggtctaaaa catcagcgaa cgaaagaacg tctcttttga aaaaatggta tgagctgatt       180
     gttgaacata aagaagagct tgcagattta attacaaagg aaaacggaaa accataccag       240
     gaagcagtcg gcgaggtact ttacggcgca ggctatatcg aatggttcgc agaggaagcg       300
     aagcgtgtgt acggaagaac ggtcccggcc ccgacaactg gtaaacgaat tgttgtcaca       360
     cgccagccgg tcggccccgt tgctgctatc acgccctgga atttcccgaa tgcgatgatt       420
     acacgcaaag cggcgcctgc tcttgccgcc ggctgtacat ttatcatcaa gccggcgccg       480
     gacacaccgc tgtctgctta tgaactagcg cgcctcgcat atgaagcggg cattccgaag       540
     gatgttcttc aggttgtgat cggcgatgga gaagaaatcg gaaatgtgtt cacaagcagt       600
     ccgaaaatcc gcaaaatcac gttcacaggc tcaacacctg tagggaaaat ccttatgaaa       660
     aacagcgctg acaccgtaaa gcacgtctca atggagctcg gcggacacgc cccgctgatc       720
     gtagatgaag atgcggacat tgaccttgcc gttgaacagg cgatggcgtc caaataccga       780
     aacgccggcc aaacctgcgt atgtgccaac cgcctgatcg ttcatgaatc cattaaagat       840
     gaatttgctg cgaaactgag cgagcaagtg tctaagctga aagtcggaaa tggacttgag       900
     gaaggcgtca atgtcggccc gattatcaac aaacgaggct tcgaaaaaat cgtcagccaa       960
     atagatgatg cggttgaaaa aggcgcgaaa gtgattgctg ggggcacata tgaccgaaac      1020
     gatgacaaag ggtgctactt tgtgaatccg acagtgctca ccgatgtcga tacgtccatg      1080
     aacatcatgc atgaggaaac attcggcccg gtcgccccga tcgtcacgtt ttctgatatt      1140
     gatgaagcga ttcagcttgc caacgataca ccgtatggct tggctgctta cttcttcaca      1200
     gaaaactacc gccgcggcat ctatatttcc gagaatctag agtatggcat tatcggctgg      1260
     aatgacggcg gaccgtcagc ggttcaagcg ccattcggcg gaatgaaaga aagcggcatc      1320
     ggccgtgaag gcggttcaga aggtatcgag ccgtaccttg aaacaaaata tttgtccatc      1380
     ggtttataa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page