(data stored in SCRATCH zone)

EMBL: AL009126.GABR

AL009126.GABR        Location/Qualifiers
FT   CDS_pept        complement(440025..441464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabR"
FT                   /locus_tag="BSU_03890"
FT                   /old_locus_tag="BSU03890"
FT                   /product="transcriptional regulator (GntR/MocR family) with
FT                   PLP binding site (GabR-GABA-PLP aldimine)"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15223311, 24127574, 25388514,
FT                   27640111, 28348215, 28412355; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03890"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12197"
FT                   /db_xref="GOA:P94426"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:4MGR"
FT                   /db_xref="PDB:4N0B"
FT                   /db_xref="PDB:4TV7"
FT                   /db_xref="PDB:5T4J"
FT                   /db_xref="PDB:5T4K"
FT                   /db_xref="PDB:5X03"
FT                   /db_xref="SubtiList:BG12042"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94426"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15223311, 24127574, 25388514, 27640111, 28348215,
FT                   28412355"
FT                   /protein_id="CAB12197.1"
FT                   /translation="MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKREL
FT                   AENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHI
FT                   DQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLIS
FT                   LTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTI
FT                   MLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDY
FT                   DSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDL
FT                   QTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGL
FT                   HFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQ
FT                   EGVQRLFKAVYGHKKIPVTGD"
     atggatatca cgattacact cgatcgttca gaacaagccg attatatcta tcagcaaatt        60
     tatcaaaagc tgaaaaaaga aatcctcagc cgcaatctgc tgccgcactc gaaggttccc       120
     tccaagcggg agctggctga aaatctcaag gtcagcgtaa attcagtgaa ttcagcctat       180
     cagcagctgc tggctgaggg gtatttgtac gccattgaac gaaagggttt cttcgtggag       240
     gaactagaca tgttttccgc cgaggagcac cctccatttg cactgccgga tgacctaaaa       300
     gagattcaca tcgaccagag cgattggata tcgttttcac acatgagttc cgatacagac       360
     cattttccga tcaaaagctg gttccgctgc gagcaaaaag cggcctcccg ctcataccgc       420
     acgctcggcg atatgtcaca tccgcaaggg atatatgaag tgagagcggc cattacgagg       480
     ctcatttccc tgacgagggg tgtaaaatgc aggccggaac aaatgatcat aggggcaggc       540
     acacaggtgc tcatgcagct gttgactgag cttttaccca aggaagccgt gtatgcgatg       600
     gaggagcctg gctacaggcg catgtatcag cttttgaaga atgccggaaa acaagtaaag       660
     acgatcatgc tggatgaaaa aggcatgtcg attgctgaaa tcaccagaca gcagccagat       720
     gtgctggtga ccaccccgtc gcatcagttt ccgtccggaa cgattatgcc tgtatccaga       780
     agaattcagc tgctgaactg ggcagccgag gagccgcgcc gatatatcat tgaggacgat       840
     tatgatagtg aattcacata tgatgtagac agtattccgg cgctgcaaag cctcgaccgt       900
     tttcaaaatg tcatctatat gggaaccttt tcaaagtccc ttctccccgg cttacggatc       960
     agctatatgg tgttgccgcc tgagctgttg agggcataca aacagcgggg ctatgatctg      1020
     cagacttgct catcactcac acagctcacc ctgcaggaat ttatcgagtc tggtgaatat      1080
     cagaagcata taaaaaaaat gaagcagcat tataaagaaa agagagaacg cctgatcacc      1140
     gctttagaag cagagttcag cggagaggtt accgtaaaag gggcaaatgc ggggctgcat      1200
     tttgttaccg aatttgatac caggcgcacc gaacaagaca tcctgtcaca tgctgccggg      1260
     ctgcagcttg aaatattcgg aatgagccga tttaacttga aggaaaacaa gcggcaaacg      1320
     ggcaggcctg ctctcattat cggctttgca cggctgaagg aagaagatat tcaggagggt      1380
     gtgcagcggc ttttcaaagc ggtttacgga cataaaaaaa tccccgttac aggggattga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page