(data stored in ACNUC7421 zone)

EMBL: AL009126.GABT

AL009126.GABT        Location/Qualifiers
FT   CDS_pept        441571..442881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BSU_03900"
FT                   /old_locus_tag="BSU03900"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /function="16.8: Protect"
FT                   /EC_number="2.6.1.19"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 4590473, 12123465, 12354229,
FT                   15590624, 9723923, 19854901, 24529384; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12198"
FT                   /db_xref="GOA:P94427"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="SubtiList:BG12043"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94427"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:4590473, 12123465, 12354229, 15590624, 9723923,
FT                   19854901, 24529384"
FT                   /protein_id="CAB12198.1"
FT                   /translation="MSQTTASITTAQWQQKRDQFVSKGVSNGNRSLAVKGEGAELYDLD
FT                   GRRFIDFAGAIGTLNVGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIELAEKLCGIAP
FT                   GSHEKKAIFLNSGAEAVENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKF
FT                   GFGPFAPEVYQAPFPYYYQKPAGMSDESYDDMVIQAFNDFFIASVAPETVACVVMEPVQ
FT                   GEGGFIIPSKRFVQHVASFCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSK
FT                   SLAAGLPLSGVIGRAEMLDAAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEEI
FT                   GKIIEDKAYEWKQEFPFIGDIRRLGAMAAIEIVKDPDTREPDKTKAAAIAAYANQNGLL
FT                   LLTAGINGNIIRFLTPLVISDSLLNEGLSILEAGLRA"
     atgagtcaaa caacagcaag catcacaact gcacaatggc agcaaaaacg ggatcaattt        60
     gtgtcaaaag gtgtgagcaa cggcaaccgc agtctggcgg tcaaaggaga aggggccgag       120
     ctgtacgatc tggatggccg gagatttatt gattttgcag gcgccatcgg cacgttaaat       180
     gtcggacact cgcatccgaa ggtggttgag gctgtgaagc ggcaggcgga ggagctgatt       240
     catcctggtt ttaatgtcat gatgtacccg acttatatcg aattagcaga aaaactgtgc       300
     ggcatcgcgc cgggcagcca tgagaaaaaa gcgatttttc ttaactcagg ggcagaagcg       360
     gtcgaaaacg ctgtgaaaat cgccagaaag tatacaaagc gccaaggcgt tgtctcgttt       420
     acacgcgggt ttcacgggcg cacgaatatg acgatgagca tgacaagcaa ggtaaaacct       480
     tataaattcg gtttcgggcc ttttgcgcca gaggtttatc aagcgccgtt cccttattat       540
     tatcagaagc cggccggcat gagtgatgaa agctatgacg atatggtcat tcaagcattc       600
     aatgatttct ttatcgcttc agtggcgcct gaaacggtgg cgtgtgtcgt gatggagcca       660
     gtgcagggag aaggcggatt tattattcct tcgaaacggt tcgtacagca cgtcgcttca       720
     ttctgcaaag aacacggcat tgtttttgtt gctgatgaaa tccaaaccgg ctttgccaga       780
     actggcactt atttcgcaat tgagcacttt gatgtagtgc ccgatctgat cacggtttct       840
     aaatcgcttg cggcaggcct gccattaagc ggtgtgatcg ggcgtgcgga aatgcttgat       900
     gcggcagcgc caggggagct gggcggcacg tatgccggca gcccgctcgg ctgcgcggcg       960
     gctttggcag tcttggatat tatcgaagaa gaaggactga atgagcgatc tgaagaaatt      1020
     ggcaaaatca ttgaagacaa ggcgtatgag tggaaacaag aattcccgtt catcggtgac      1080
     atccgcagac tcggggcgat ggccgcaatc gaaatcgtca aggatcctga cacgcgtgag      1140
     cctgataaga caaaagcagc agcgatcgcg gcctatgcga atcaaaacgg attacttttg      1200
     ctgacagcgg gaattaacgg taatatcatc cgctttttga caccgctcgt catctcagac      1260
     agcctattaa atgaagggct cagcatcttg gaggcgggcc tgcgagctta a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page