(data stored in SCRATCH zone)

EMBL: AL009126.GAMA

AL009126.GAMA        Location/Qualifiers
FT   CDS_pept        complement(256823..257572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamA"
FT                   /locus_tag="BSU_02360"
FT                   /old_locus_tag="BSU02360"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="3.5.99.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23667565, 27002132; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02360"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12030"
FT                   /db_xref="GOA:O31458"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="SubtiList:BG12746"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31458"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23667565, 27002132"
FT                   /protein_id="CAB12030.1"
FT                   /translation="MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYK
FT                   QLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQG
FT                   DNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQ
FT                   ANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPA
FT                   SILQKHNHVTVIADYKAAQKLKSASFS"
     atgaagattc tgatcgccga gcactacgaa gaactctgta agttaagcgc tgccattatt        60
     aaagaacaaa tacaagctaa gaaagatgcc gttctcggcc tggcaacagg aagcacaccg       120
     gtcggcttgt ataagcagtt gatttcagac tatcaggcag gcgaaattga tttttcaaag       180
     gttactacat ttaatttgga tgaatatgct ggtctctctc catctcatcc gcaaagttat       240
     aaccatttta tgcatgagca tctttttcag catatcaata tgcagcctga tcatattcat       300
     atcccgcaag gagacaatcc gcagcttgag gcggcatgca aagtatacga ggatctcatc       360
     cgccaggcgg gaggcattga tgtccaaatt ctcggcatcg gcgccaatgg ccatatcggt       420
     tttaatgaac cgggatctga ttttgaagac cggacacgtg ttgtgaagct ctcggaaagc       480
     acgatacagg caaatgccag attcttcggc ggcgatccgg tgctggttcc gagactcgcg       540
     atttcaatgg gcattaaaac catcatggaa ttcagcaaac atattgtgct tttagcaagc       600
     ggcgaggaaa aagcagacgc cattcaaaag atggctgaag gtcctgtcac gacagatgta       660
     ccagcctcca ttcttcaaaa acacaatcat gtaaccgtta tcgccgatta taaagcagct       720
     caaaaattaa agagtgcatc attctcataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page