(data stored in ACNUC7421 zone)

EMBL: AL009126.GAMP

AL009126.GAMP        Location/Qualifiers
FT   CDS_pept        complement(254907..256802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gamP"
FT                   /locus_tag="BSU_02350"
FT                   /old_locus_tag="BSU02350"
FT                   /product="phosphotransferase system (PTS)
FT                   glucosamine-specific enzyme IICBA component"
FT                   /function="16.1: Circulate"
FT                   /EC_number="2.7.1.193"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10627040, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12029"
FT                   /db_xref="GOA:P39816"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="SubtiList:BG11014"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39816"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12029.1"
FT                   /translation="MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKD
FT                   AGGVVFDNLPLIFAVGVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGA
FT                   EHLIDMGVFGGIIIGLLAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFS
FT                   FVWPLIQNGINAASSLIADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPST
FT                   GNTVTGDLTRFFAGDPTAGRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISA
FT                   ALTSMLTGITEPVEFSFLFVAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVL
FT                   NYGLSTNGWVVIPVGIVFAFIYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQL
FT                   AFHVLQALGGQQNIANLDACITRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFG
FT                   TKSDALKDDIKTIMAGGVPATAAALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQV
FT                   FSEKMMGEGFAIIPSEGKVVAPADGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLN
FT                   GEGFEAHVTSGQAVKQGELLLTFDLNYIKQHAASAITPVIFTNTSEEDLKHIQMK"
     atgtttaaaa aggcatttca aattctgcag cagcttggcc gcgcgttgat gactccggtt        60
     gccgtcctgc cggcagcagg tcttttgctc cgtttcggag acaaggattt actgaacatc       120
     cctattataa aggatgcggg cggcgttgta ttcgataacc ttccgctgat tttcgccgtg       180
     ggggtcgcga tcggattagc cggcggagaa ggtgtagccg gacttgccgc tgtcatcgga       240
     tacttaattt taaccgtcac cctcgacaat atgggaaaat tactcggcct tcagcctccg       300
     tatgaaggag ccgagcacct gattgatatg ggggttttcg gaggaatcat tatcgggctt       360
     ctcgccgcct atttatataa gcgattttca tcaatcgagc tgcatccggt ccttggattt       420
     ttctctggaa aacgctttgt cccgatcatt acttccgtca gttcattggt gatcggcgtc       480
     attttctcat tcgtttggcc gctgatccaa aacggaatta acgcagccag cagtttaatt       540
     gccgattcaa cagtcggcct gttcttttat gcaacgatct atcgtttgct gattcctttt       600
     ggcctgcatc atatttttta tacgcctttc tattttatga tgggagaata cacagaccca       660
     tcaacaggca acaccgtaac cggcgacctg acaaggtttt tcgcgggaga cccgacagcc       720
     gggcgcttta tgatggggga tttcccttac atgattttct gtctgccggc cgttgctctt       780
     gccattatcc ataccgcgcg tccggaaaag aaaaaaatga tctccggcgt gatgatttct       840
     gcggcgctca catctatgct gaccggaatt acagaaccgg ttgagttttc tttcttgttc       900
     gttgcgcccg tgctctattt gattaactct attcttgccg gcgtcatctt tgtcgtttgt       960
     gatttattcc atgtccgcca cggctatacg ttctcaggcg gaggaattga ctacgtcttg      1020
     aactacggac tgtctacaaa cggctgggtt gtcattcctg tcgggatcgt gtttgctttc      1080
     atttattatt atttgttccg atttgcgatt ctgaaatgga atttgaaaac gcccggccgt      1140
     gagacagatg aagacggtca gaatgaggag aaagctccag ttgcaaaaga ccagcttgcc      1200
     tttcacgtgc tgcaggcctt gggcggacag caaaatatcg ctaacctgga tgcatgtatc      1260
     acaaggcttc gtgtgaccgt tcatcagcca agccaagtct gcaaggatga attaaaacgg      1320
     cttggtgcag taggtgtgct ggaggtcaac aacaacttcc aggcaatatt cggaaccaag      1380
     tccgatgcct taaaagacga catcaaaaca atcatggccg gaggcgtccc tgccaccgcc      1440
     gccgcgctgg acacggtaac tgacaaaccg ctgaagcccg attccgatga gacctttatt      1500
     tatccgatta aaggagaaac agtctcttta ggggatgtgc ctgatcaggt cttttcagaa      1560
     aaaatgatgg gcgagggatt tgcgattata ccatcagaag gaaaagtcgt tgcacctgcg      1620
     gacggcgaga tcgtctcgat ttttccgaca aaacacgcca tcggctttat gagcgccggc      1680
     ggcactgaaa tcctgattca tgtcggcatc gataccgtca aactgaatgg ggaaggcttt      1740
     gaagcacatg tcacaagcgg acaagccgtc aaacaaggcg aactgcttct cacctttgat      1800
     ctcaattaca tcaagcagca tgccgcttca gccataacac cggttatttt cacaaatacc      1860
     tctgaagaag atctaaagca cattcaaatg aagtaa                                1896
//

If you have problems or comments...

PBIL Back to PBIL home page