(data stored in ACNUC7421 zone)

EMBL: AL009126.GARD

AL009126.GARD        Location/Qualifiers
FT   CDS_pept        274029..275561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garD"
FT                   /locus_tag="BSU_02510"
FT                   /old_locus_tag="BSU02510"
FT                   /product="D-galactarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.42"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9772162; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12045"
FT                   /db_xref="GOA:P42240"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017654"
FT                   /db_xref="SubtiList:BG11163"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42240"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12045.2"
FT                   /translation="MAMNLRKNQAPLYIKVHEIDNTAIIVNDGGLPKGTVFSCGLVLEE
FT                   DVPQGHKVALTDLNQGDEIVRYGEVIGFADETIKRGSWIREALVRMPAPPALDDLPLAN
FT                   RVPQPRPPLEGYTFEGYRNADGSAGTKNILGITTSVQCVVGVLDYAVKRIKEELLPKYP
FT                   NVDDVVPLHHQYGCGVAINAPDAVIPIRTIQNLAKHPNFGGEVMVIGLGCEKLLPERIA
FT                   SENDDDILSLQDHRGFAAMIQSILEMAEERLIRLNSRTRVSCPVSDLVIGLQCGGSDAF
FT                   SGVTANPAVGYAADLLVRAGATVLFSEVTEVRDAIHLLTPRAVSEEVGQSLIKEMKWYD
FT                   SYLRRGDADRSANPSPGNKKGGLSNVVEKALGSVAKSGTSPISGVLGPGERAKQKGLLF
FT                   AATPASDFVCGTLQLAAGMNLQVFTTGRGTPYGLAAAPVLKVSTRHSLSEHWADLIDIN
FT                   AGRIATGEASIEDVGWEIFRTILDVASGRKQTWADRWGLHNDLCLFNPAPVT"
     atggcgatga acctcaggaa gaaccaagcc cccctttaca tcaaagtgca tgaaatagat        60
     aacaccgcga ttattgtaaa tgatggaggg ctgccaaagg gcactgtttt ctcatgcggg       120
     ctcgtacttg aagaggatgt tcctcaaggc cataaggtgg ccctcaccga tctcaatcaa       180
     ggggacgaga tcgtgcgtta cggagaggtg atcggatttg ctgatgagac gatcaaacgc       240
     gggagctgga tacgggaagc cctcgtgaga atgcccgctc ctccggcgtt agacgatctt       300
     cctctcgcaa acagggtgcc gcagccgcgg cccccacttg aaggatatac atttgaagga       360
     taccgaaatg cggatggcag tgcggggaca aaaaatatcc tcggcatcac gacaagtgtt       420
     caatgtgttg ttggcgtttt ggattatgca gtcaaacgaa taaaagaaga gctgctgccg       480
     aaatacccaa atgtcgatga cgttgtgccg ctgcatcatc aatacggatg cggcgtggcg       540
     atcaatgcgc ccgacgctgt cattccgatc cgcacgattc aaaatcttgc gaagcatccg       600
     aacttcggcg gtgaagtaat ggtaatcgga ttgggatgtg aaaagctcct cccggaaaga       660
     attgcctccg aaaatgatga tgacattcta tcgctccagg atcaccgagg ttttgcggcg       720
     atgatccaat ccattttgga aatggcggag gaacggttaa tcaggctgaa cagcagaacc       780
     cgggtgtcat gccctgtttc ggatctggtt atcggcctgc aatgcggcgg cagtgatgcg       840
     ttttccggcg tgacggcgaa ccctgccgtg gggtatgcgg ctgatttatt ggttcgcgca       900
     ggtgcaacgg ttttgttttc tgaagtgaca gaggtgcggg atgccattca tttattaacg       960
     ccgcgggctg tcagtgaaga ggtcggacaa tcgctgatca aagagatgaa gtggtatgac      1020
     agctatcttc ggcggggaga cgcagaccgt agcgcaaacc cgtcaccagg caataaaaaa      1080
     ggcggattat ccaatgtggt ggaaaaagcg ttaggttcgg tagcgaaatc aggcacaagc      1140
     cccatctccg gcgtgctcgg ccctggtgaa agagcaaagc aaaaaggcct gctgttcgcg      1200
     gcgacaccgg caagcgattt tgtgtgcggc accctgcagc tggctgcggg catgaatttg      1260
     caggtgttta cgacagggag aggaacacca tatggcctgg ctgctgcgcc ggttctgaaa      1320
     gtatcgacgc ggcattcctt atcagagcat tgggctgatt taatcgatat caatgccggc      1380
     cgaatcgcga caggagaggc cagtatcgaa gacgtaggct gggaaatctt caggacgatt      1440
     ttggatgtgg caagcggccg caaacaaacg tgggcagacc gttggggtct tcataatgat      1500
     ttgtgcttgt ttaatcctgc tccagtgact tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page