(data stored in ACNUC7421 zone)

EMBL: AL009126.GDH

AL009126.GDH         Location/Qualifiers
FT   CDS_pept        445344..446129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="BSU_03930"
FT                   /old_locus_tag="BSU03930"
FT                   /product="forespore glucose 1-dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.47"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2493633, 3141376, 6438057,
FT                   16912926; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03930"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12201"
FT                   /db_xref="GOA:P12310"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG10545"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12310"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2493633, 3141376, 6438057, 16912926"
FT                   /protein_id="CAB12201.1"
FT                   /translation="MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDP
FT                   NEVKEEVIKAGGEAVVVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEM
FT                   PLKDWDKVIGTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKG
FT                   GIKLMTETLALEYAPKGIRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPE
FT                   EIAAVAAWLASKEASYVTGITLFADGGMTQYPSFQAGRG"
     atgtatccgg atttaaaagg aaaagtcgtc gctattacag gagctgcttc agggctcgga        60
     aaggcgatgg ccattcgctt cggcaaggag caggcaaaag tggttatcaa ctattatagt       120
     aataaacaag atccgaacga ggtaaaagaa gaggtcatca aggcgggcgg tgaagctgtt       180
     gtcgtccaag gagatgtcac gaaagaggaa gatgtaaaaa atatcgtgca aacggcaatt       240
     aaggagttcg gcacactcga tattatgatt aataatgccg gtcttgaaaa tcctgtgcca       300
     tctcacgaaa tgccgctcaa ggattgggat aaagtcatcg gcacgaactt aacgggtgcc       360
     tttttaggaa gccgtgaagc gattaaatat ttcgtagaaa acgatatcaa gggaaatgtc       420
     attaacatgt ccagtgtgca cgaagtgatt ccttggccgt tatttgtcca ctatgcggca       480
     agtaaaggcg ggataaagct gatgacagaa acattagcgt tggaatacgc gccgaagggc       540
     attcgcgtca ataatattgg gccaggtgcg atcaacacgc caatcaatgc tgaaaaattc       600
     gctgacccta aacagaaagc tgatgtagaa agcatgattc caatgggata tatcggcgaa       660
     ccggaggaga tcgccgcagt agcagcctgg cttgcttcga aggaagccag ctacgtcaca       720
     ggcatcacgt tattcgcgga cggcggtatg acacaatatc cttcattcca ggcaggccgc       780
     ggttaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page