(data stored in SCRATCH zone)

EMBL: AL009126.GERKA

AL009126.GERKA       Location/Qualifiers
FT   CDS_pept        420110..421744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BSU_03700"
FT                   /old_locus_tag="BSU03700"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 16707705, 16740944;
FT                   Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12178"
FT                   /db_xref="GOA:P49939"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="SubtiList:BG11392"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49939"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 16707705, 16740944"
FT                   /protein_id="CAB12178.1"
FT                   /translation="MPLFSKRKNNTDSKDKQNTDERNQEQQQEKERPVLISPSLAKNIA
FT                   ETKKEVGSSSDVIIREIKIGEQDHVHLAVIYISGLVDNNTIHESLIDPLVQDESIQNTH
FT                   AIQQILEKTLPLGGVKAEKSWDKLFSELMLGNALIFADGHDEALICSTQGGEQRSIQEP
FT                   STQVSFRGPRQGFTESLQTNISMIRRYIKNPNLWVEKMKKGSVTNTDIALMYIQGICDE
FT                   KVLKEVKQRLEKIDIDSILESGYIEQLIEDETFTTFPTMYHTERPDVVAGNLLEGRFAI
FT                   IVDGTPFVLIAPALFVQFFQSVEDYYSRFDIATSIRILRVLVFFISLVAPAVYVAATTF
FT                   HQEMIPTQLLVVIAAQREIVPFPAVVEALTMEVAFEILREAGVRLPRVVGSAVSIVGAL
FT                   VIGQAAVQAGIVSPAMVIIVALTAIASFATPAFAMAISARLIRFIFIIASAVMGFYGLI
FT                   LGIIMMFVHLCSLRSFGVPYMSPLAPFSSQGVKDALFRVPWWADEKRPESVSKEDKVRQ
FT                   GKDQRPEPAASRGMVNKDLEEGDQNGT"
     atgcctttat tttctaagcg aaagaacaat accgattcaa aagacaagca gaatacagac        60
     gaaaggaatc aggaacagca gcaagaaaaa gaaaggccgg ttctcatttc tccaagttta       120
     gcaaagaata tagcggaaac gaaaaaggaa gtcggaagca gctctgacgt catcattcgc       180
     gagattaaaa tcggggagca ggatcatgtc cacctagctg ttatctatat ttctgggctg       240
     gtcgataata acacgatcca tgagtcgtta attgacccat tggtacagga tgagtctatc       300
     cagaatactc atgcgatcca gcaaattctt gaaaaaacgc tcccgctggg cggggtgaaa       360
     gcggaaaaga gctgggacaa gcttttttcc gagttaatgc ttggcaatgc gctcattttt       420
     gctgatggcc atgatgaagc tttgatttgc agcactcaag ggggagagca gcgctccatc       480
     caagagccga gcacccaggt gtcattccgc ggcccgcgcc aagggtttac agagtctctg       540
     caaaccaata tttccatgat ccggcgatac attaaaaatc cgaatttatg ggttgaaaaa       600
     atgaaaaaag gttctgttac gaatacggat atcgctctca tgtacattca aggaatatgt       660
     gatgaaaagg tgctgaagga agtgaaacag cgcctggaaa aaatagatat tgacagtatt       720
     ttggaatctg gatatattga gcagctgatt gaagatgaaa cctttacgac gtttccgact       780
     atgtatcata cagaacgccc tgatgttgta gcgggtaatc tgttagaagg aagattcgcg       840
     attattgtgg acggaacacc gtttgtgctt attgccccag ccttatttgt ccagtttttt       900
     cagtctgttg aggattatta ttcgcgtttt gacattgcga caagcataag aattcttcgt       960
     gttttagtct ttttcatttc gcttgtggca ccagctgtat acgtggcagc cacgacgttt      1020
     catcaagaaa tgataccgac tcagctgtta gtggtcattg cggcccagcg ggaaattgtc      1080
     ccgtttccgg ctgttgtgga ggcgctgacg atggaggttg cttttgagat tctgagggaa      1140
     gcgggagtca ggctgccccg ggttgtcggc tcggcagtgt caatcgtagg cgcgctcgta      1200
     atcggccagg ctgccgtaca ggctggtatc gtctctccgg caatggtgat tatcgtggca      1260
     ctcaccgcga ttgcgagctt cgcaacaccg gcgtttgcaa tggcgatttc agcccggctt      1320
     attcggttta tctttattat tgcctcagct gttatgggtt tttacgggct gattttaggg      1380
     atcattatga tgtttgtcca cttatgcagt cttcgttcat tcggcgttcc atatatgtcg      1440
     ccgcttgcac ctttttcttc acaaggcgta aaggacgcgc ttttccgggt tccgtggtgg      1500
     gccgatgaaa aaaggccgga atcggtcagc aaggaagata aggtgcggca ggggaaagat      1560
     caacgcccag agccggccgc ttcacgagga atggtgaaca aagatttgga agaaggggat      1620
     cagaatggta cgtaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page