(data stored in ACNUC7421 zone)

EMBL: AL009126.GERKB

AL009126.GERKB       Location/Qualifiers
FT   CDS_pept        422982..424103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BSU_03720"
FT                   /old_locus_tag="BSU03720"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 15849754, 16707705,
FT                   16740944, 16850406, 19363077; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03720"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12180"
FT                   /db_xref="GOA:P49940"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="SubtiList:BG11393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49940"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 15849754, 16707705, 16740944, 16850406,
FT                   19363077"
FT                   /protein_id="CAB12180.1"
FT                   /translation="MEKARISIRQLFVMIIIFELGSSLLITPGSMAGRDAWIAVLLGCA
FT                   IGLFLFYLYQGIYQCYPNSSPKEYMDDMLGTKLSWLFSFLYILYFAYIAARVLRDFGEM
FT                   LLTFAYHDTPIIIVNALLMVVSIYAVRKGIEVLARAAELLFGAMYLLGAIGLVLIIVSG
FT                   TIDPHNLKPVLANGISPVLHSVFTQTMYVPFGEVVLFVMIFPNLNDRKDVKKMGMIAMA
FT                   ISGLIVALTVAINISVLDVDLTLRSQFPLLSTIQTIKVEEFLDRLDVFFMLALIIGGFF
FT                   KVSLYLYATVVGTSTLFKEKNPSQLAYPMGLGILILSITIATNFSEHLNEGLNVVPLYI
FT                   HLPFQLLFPLFLFIVAVWKKKRREKSKGEEAKK"
     atggaaaaag ccagaataag cataaggcag ttgtttgtca tgattatcat ttttgaactg        60
     ggcagctcct tattgattac accgggatca atggcgggca gggatgcttg gatagcagtt       120
     ttattaggct gtgcgatcgg actgtttctt ttctatttgt atcaaggcat ttatcaatgt       180
     tatccgaatt cttctccgaa agaatatatg gatgatatgc tgggaaccaa gctgagctgg       240
     ctgttttcat ttctctatat cttgtacttt gcctatattg ccgcaagggt gctgcgtgac       300
     tttggagaaa tgctgctgac gtttgcttat catgatacac ctatcattat tgtaaatgct       360
     ttattaatgg tagtaagcat atatgccgta agaaaaggaa ttgaagtact cgcacgcgcg       420
     gccgaacttc ttttcggggc catgtattta ctgggcgcga tcggccttgt gctgattatt       480
     gtctcaggga ctatagaccc gcacaattta aagccggttt tggcaaacgg catttctcct       540
     gtccttcact ctgttttcac acagaccatg tacgttccat ttggtgaagt tgttttattt       600
     gtgatgattt tccctaacct gaatgacaga aaagatgtga aaaaaatggg gatgatcgcc       660
     atggctatta gcggattgat tgtggcgctc accgtggcga ttaatattag cgtgcttgat       720
     gttgatctta cactcagatc ccagtttccg cttttaagca cgatccagac aatcaaggtc       780
     gaagaatttt tagaccggct cgatgtcttt tttatgctgg cgctgatcat cggcggcttc       840
     tttaaggtca gcctctactt atatgccact gtggttggga catctacgct ctttaaggaa       900
     aagaacccct ctcaattggc ttatccgatg ggattgggca tcttaatcct ttctataacg       960
     atcgcgacta acttttcgga gcacttgaat gaaggcctga acgtggtgcc gctgtatatt      1020
     catttgcctt ttcaattatt gtttccgctc tttctgttta ttgtggccgt ttggaaaaag      1080
     aaacgaagag agaagtcaaa aggggaggaa gcaaaaaaat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page