(data stored in ACNUC7421 zone)

EMBL: AL009126.GERKC

AL009126.GERKC       Location/Qualifiers
FT   CDS_pept        421734..422957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BSU_03710"
FT                   /old_locus_tag="BSU03710"
FT                   /product="spore germination receptor subunit"
FT                   /function="16.5: Explore"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10762253, 16707705, 16740944,
FT                   19363077; Product type cp: cell process"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12179"
FT                   /db_xref="GOA:P49941"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="SubtiList:BG11394"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49941"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10762253, 16707705, 16740944, 19363077"
FT                   /protein_id="CAB12179.1"
FT                   /translation="MVRKCLLAVLMLLSVIVLPGCWDKRELTDLAIISAIGIDRTNDSN
FT                   YVLHLQIINPGNVAGGLQGGGAGDRPPVSVYSIEGNNITEALRKASMKVSRRLYFAHTN
FT                   LVVINEKLAKEEGLDFVLDNLDRDTEFRTTATFVVAHKTKAENIVKILTPIDKIPSNKV
FT                   NKTLDFTEAQYGRVVKINIQDVLKTLAANTMAPVIPGYMMIGDDKKGVSMENTQATDPK
FT                   AILQADGLAVFDKAGYLKYWLEDDESVGAVWLMNKIQHTFINADWGKTKDAVSLQVTHQ
FT                   DTKLVPKMRNGRPYIHVKVSVEGIIDAVKYPFQLSDPKVLAAIEKALNKELEKEISHTV
FT                   KKIKKNKIDFIGFGDTIYRKYPEQWEKMKDTWDKEYLPELPIDVKAETYIRRTGLRNNP
FT                   IKHQFKDD"
     atggtacgta aatgtctatt agccgttctc atgcttttga gcgtcattgt gctgcccggc        60
     tgctgggata agcgggagct gacggatctt gcgattatct cggcgattgg catcgatcgg       120
     acaaacgaca gcaactacgt gctgcatctt caaattatca atccaggaaa tgttgccggc       180
     ggccttcagg gaggcggtgc tggagacagg ccgcctgtat ctgtctattc gattgaaggt       240
     aacaatataa cggaagcact cagaaaagcc tccatgaagg tatcacggcg gctttatttt       300
     gcccatacca atctagtcgt gatcaatgaa aagctggcaa aagaagaagg tttggatttt       360
     gtattagata atcttgaccg ggacacagaa ttcaggacaa cagcaacatt cgtcgttgcc       420
     cataaaacaa aagcagaaaa tattgtgaaa atcttgacgc cgattgataa aattccgtca       480
     aataaagtca ataaaacact cgatttcacg gaggcacaat acgggcgggt ggtcaaaatc       540
     aatattcagg acgttttgaa aacacttgcc gccaacacta tggcaccggt catccccgga       600
     tatatgatga ttggtgacga taaaaaagga gtcagcatgg aaaacacgca ggcgactgac       660
     ccgaaagcca ttcttcaggc agatggtttg gcggtttttg ataaggcagg atatttaaag       720
     tattggctgg aagatgatga aagcgtgggg gcagtctggc ttatgaataa gatccagcat       780
     acgtttatta atgctgactg gggcaagacg aaggatgcgg tcagcttgca ggttacccat       840
     caagatacaa agctggtacc gaaaatgcgg aacggacgcc cgtacatcca tgtgaaagtg       900
     tcggttgaag gtattataga tgctgtcaaa taccctttcc aattgtctga tcccaaggtg       960
     ctggccgcta ttgaaaaagc gctcaacaaa gagcttgaaa aggaaatcag ccatactgtg      1020
     aaaaagatta agaagaataa aatagatttt atcggttttg gtgacacgat atatagaaag      1080
     tatccggagc agtgggagaa aatgaaggac acttgggaca aagaatattt gccggaactg      1140
     cccatcgatg tgaaggccga gacgtatatc agaaggacgg gattgcgaaa caatccgatc      1200
     aaacaccagt ttaaagatga ttag                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page