(data stored in SCRATCH zone)

EMBL: AL009126.GLCU

AL009126.GLCU        Location/Qualifiers
FT   CDS_pept        444461..445324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcU"
FT                   /locus_tag="BSU_03920"
FT                   /old_locus_tag="BSU03920"
FT                   /product="glucose uptake protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10438764, 15849754, 16850406,
FT                   19054326, 21564334, 27329749; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12200"
FT                   /db_xref="GOA:P40420"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="SubtiList:BG11066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40420"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12200.1"
FT                   /translation="MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVI
FT                   YFFVQPVLSLRIFIVGIVSGLFWSLGQANQLKSIQLMGVSKTMPISTGMQLVSTSLFGV
FT                   IVFREWSTPIAITLGVLALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVSTLGY
FT                   LVYVVVARLFNVSGWSALLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMF
FT                   LFISQPRVGVATSFSLSQMGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLG
FT                   IAKTNS"
     atggatttat tattggctct tctcccggct ttgttttggg ggagcattgt tctcttcaat        60
     gtgaaattag gcggcgggcc gtacagccag acactgggaa cgacgatcgg ggcactcatt       120
     gtttctatcg ttatttactt ttttgttcag cccgttctgt cccttcgcat ttttattgtt       180
     ggaatcgtat ccggcttatt ttggtcactt ggacaggcca accagttgaa aagcattcaa       240
     ttgatgggcg tgtcgaaaac aatgccgatt tccacaggaa tgcagctcgt ttccacctcg       300
     ctgttcggtg tgatcgtgtt ccgcgaatgg tcaacaccga ttgcgattac gcttggcgtt       360
     ctcgctttga tctttatcat tgtgggaatc attctcacgt ccttggaaga taagaatgat       420
     aaaaaagagg gcgagccaag caatttgaaa aagggcattt tgattctcct tgtttcgact       480
     cttggttatt tggtttatgt agtcgtggct agattattca atgtgtccgg ctggtccgcg       540
     ctgctgccac aggcaattgg catggtggtc ggggggttag ttttaaccta tagacacaaa       600
     ccctttaaca agtatgcgat cagaaatatt ctcccagggt taatctgggc aggcggaaat       660
     atgtttttgt ttatttctca gccgcgagtc ggcgttgcaa cgagcttttc cctttcacaa       720
     atgggaattg tcatttctac gctcggcggt attttcatcc tgcgtgaaaa gaaaacgaaa       780
     cgccagctaa tagcaattgc gatcgggatt atcctgatta ttgccgccgc cgtattctta       840
     ggaatcgcca aaacaaattc ataa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page