(data stored in ACNUC7421 zone)

EMBL: AL009126.GLMM

AL009126.GLMM        Location/Qualifiers
FT   CDS_pept        198497..199843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BSU_01770"
FT                   /old_locus_tag="BSU01770"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="16.6: Maintain"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.4.2.10"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10671448, 10913078, 12089032,
FT                   21154411, 26240071, 27074767; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11953"
FT                   /db_xref="GOA:O34824"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="SubtiList:BG12704"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34824"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10671448, 10913078, 12089032, 21154411, 26240071,
FT                   27074767"
FT                   /protein_id="CAB11953.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFKVGRFGGYVLTKDKQRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQEAEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFL
FT                   KQTADEDFTGIHVALDCANGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALSAFVKEKNADLGLAFDGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVV
FT                   STVMSNLGFYKALEKEGIKSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
FT                   GLLSAIMLMNTLKATGKPLSELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCDEYVNRIVEVVRSEMGLE"
     atgggcaagt attttggaac agacggtgta agaggtgtcg ccaatagtga gcttacacct        60
     gagctggcct ttaaagtcgg acgtttcggc ggttatgtgc tgacaaaaga caaacaacgt       120
     ccaaaagtgc tgataggccg cgatacacgc atctccggcc atatgctgga gggagccctt       180
     gtcgccggac ttttatccat tggcgcagaa gtcatgcgcc tgggtgtcat ttctacacca       240
     ggtgtatctt atttgacaaa agcgatggat gcagaggcgg gcgtcatgat ttccgcttct       300
     cataacccag tgcaggataa cggcatcaaa ttctttgggg gagatggatt taagctttct       360
     gatgaacagg aggctgaaat tgagcgcctg atggacgaac ctgaggataa gctgccaaga       420
     cctgtcggag cagaccttgg acttgtaaac gattattttg aaggcggaca aaaatatctg       480
     caattcttaa aacagacagc tgatgaagat ttcacaggca ttcatgtggc attggactgt       540
     gccaatggcg caacgtcatc cttggcgaca cacctgtttg ctgatttaga tgcagatgtt       600
     tctacaatgg ggacttcccc gaacggatta aacattaatg acggcgtcgg ttcgactcat       660
     cccgaagcgc tcagcgcgtt tgtcaaagag aaaaacgcgg atctcggtct tgcgttcgac       720
     ggtgacggcg accgcctgat tgctgtcgat gaaaaaggaa atattgtaga cggcgaccaa       780
     atcatgtaca tatgctcaaa acatctgaaa tcagagggcc gtttaaagga tgatacagtg       840
     gtttcaaccg tgatgagcaa cctcggcttc tataaggcgc tcgaaaaaga aggcatcaaa       900
     agcgtgcaga cagctgtcgg cgaccgctac gtagtagaag caatgaaaaa agacggctac       960
     aacgtcggcg gagagcagtc aggacatctt attttccttg attacaacac gacaggggac      1020
     ggattattgt ctgctattat gctgatgaac actttaaaag caacaggcaa gccgctgtca      1080
     gagcttgcag ctgaaatgca gaagttcccg cagctgttag tcaatgtgag agtgactgat      1140
     aaatataaag ttgaagaaaa tgaaaaagta aaagcagtta tttctgaagt tgaaaaagaa      1200
     atgaacggcg acggccggat tttggtgcgc ccttcaggaa ctgaaccgct cgtccgtgtc      1260
     atggctgaag cgaagacgaa agagctgtgc gatgagtatg tcaatcgcat tgttgaagtc      1320
     gtccggtcag aaatgggatt agagtaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page