(data stored in SCRATCH zone)

EMBL: AL009126.GLMS

AL009126.GLMS        Location/Qualifiers
FT   CDS_pept        200277..202079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BSU_01780"
FT                   /old_locus_tag="BSU01780"
FT                   /product="L-glutamine-D-fructose-6-phosphate
FT                   amidotransferase"
FT                   /function="16.13: Shape"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.16"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12682299, 15029187, 17114942,
FT                   17283212, 17322533, 23874669; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11954"
FT                   /db_xref="GOA:P0CI73"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="SubtiList:BG10948"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11954.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEQGIHVF
FT                   KEKGRIADLREVVDANVEAKAGIGHTRWATHGEPSYLNAHPHQSALGRFTLVHNGVIEN
FT                   YVQLKQEYLQDVELKSDTDTEVVVQVIEQFVNGGLETEEAFRKTLTLLKGSYAIALFDN
FT                   DNRETIFVAKNKSPLLVGLGDTFNVVASDAMAMLQVTNEYVELMDKEMVIVTDDQVVIK
FT                   NLDGDVITRASYIAELDASDIEKGTYPHYMLKETDEQPVVMRKIIQTYQDENGKLSVPG
FT                   DIAAAVAEADRIYIIGCGTSYHAGLVGKQYIEMWANVPVEVHVASEFSYNMPLLSKKPL
FT                   FIFLSQSGETADSRAVLVQVKALGHKALTITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAVLASVAADKNGINIGFDLVKELGIAANAMEALCDQKDEMEMIAREYLT
FT                   VSRNAFFIGRGLDYFVCVEGALKLKEISYIQAEGFAGGELKHGTIALIEQGTPVFALAT
FT                   QEHVNLSIRGNVKEVAARGANTCIISLKGLDDADDRFVLPEVNPALAPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
     atgtgtggaa tcgtaggtta tatcggtcag cttgatgcga aggaaatttt attaaaaggg        60
     ttagagaagc ttgagtatcg cggttatgac tctgctggta ttgctgttgc caacgaacag       120
     ggaatccatg tgttcaaaga aaaaggacgc attgcagatc ttcgtgaagt tgtggatgcc       180
     aatgtagaag cgaaagccgg aattgggcat actcgctggg cgacacacgg cgaaccaagc       240
     tatctgaacg ctcacccgca tcaaagcgca ctgggccgct ttacacttgt tcacaacggc       300
     gtgatcgaga actatgttca gctgaagcaa gagtatttgc aagatgtaga gctcaaaagt       360
     gacaccgata cagaagtagt cgttcaagta atcgagcaat tcgtcaatgg aggacttgag       420
     acagaagaag cgttccgcaa aacacttaca ctgttaaaag gctcttatgc aattgcttta       480
     ttcgataacg acaacagaga aacgattttt gtagcgaaaa acaaaagccc tctattagta       540
     ggtcttggag atacattcaa cgtcgtagca tctgatgcga tggcgatgct tcaagtaacc       600
     aacgaatacg tagagctgat ggataaagaa atggttatcg tcactgatga ccaagttgtc       660
     atcaaaaacc ttgatggtga cgtgattaca cgtgcgtctt atattgctga gcttgatgcc       720
     agtgatatcg aaaaaggcac gtaccctcac tacatgttga aagaaacgga tgagcagcct       780
     gttgttatgc gcaaaatcat ccaaacgtat caagatgaaa acggcaagct gtctgtgcct       840
     ggcgatatcg ctgccgctgt agcggaagcg gaccgcatct atatcattgg ctgcggaaca       900
     agctaccatg caggacttgt cggtaaacaa tatattgaaa tgtgggcaaa cgtgccggtt       960
     gaagtgcatg tagcgagtga attctcctac aacatgccgc ttctgtctaa gaaaccgctc      1020
     ttcattttcc tttctcaaag cggagaaaca gcagacagcc gcgcggtact cgttcaagtc      1080
     aaagcgctcg gacacaaagc cctgacaatc acaaacgtac ctggatcaac gctttctcgt      1140
     gaagctgact atacattgct gcttcatgca ggccctgaga tcgctgttgc gtcaacgaaa      1200
     gcatacactg cacaaatcgc agttctggcg gttcttgctt ctgtggctgc tgacaaaaat      1260
     ggcatcaata tcggatttga cctcgtcaaa gaactcggta tcgctgcaaa cgcaatggaa      1320
     gctctatgcg accagaaaga cgaaatggaa atgatcgctc gtgaatacct gactgtatcc      1380
     agaaatgctt tcttcatcgg acgcggcctt gactacttcg tatgtgtcga aggcgcactg      1440
     aagctgaaag agatttctta catccaggca gaaggttttg ccggcggtga gctaaagcac      1500
     ggaacgattg ccttgatcga acaaggaaca ccagtattcg cactggcaac tcaagagcat      1560
     gtaaacctaa gcatccgcgg aaacgtcaaa gaagttgctg ctcgcggagc aaacacatgc      1620
     atcatctcac tgaaaggcct agacgatgcg gatgacagat tcgtattgcc ggaagtaaac      1680
     ccagcgcttg ctccgttggt atctgttgtt ccattgcagc tgatcgctta ctatgctgca      1740
     ctgcatcgcg gctgtgatgt ggataaacct cgtaaccttg cgaagagtgt tactgtggag      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page