(data stored in ACNUC7421 zone)

EMBL: AL009126.GLMU

AL009126.GLMU        Location/Qualifiers
FT   CDS_pept        56352..57722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BSU_00500"
FT                   /old_locus_tag="BSU00500"
FT                   /product="bifunctional glucosamine-1-phosphate
FT                   N-acetyltransferase/UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1328164, 8522540, 9648743,
FT                   11124906, 20495944, 23485416, 24915076; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00500"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11826"
FT                   /db_xref="GOA:P14192"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="SubtiList:BG10113"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14192"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1328164, 8522540, 9648743, 11124906, 20495944,
FT                   23485416, 24915076"
FT                   /protein_id="CAB11826.1"
FT                   /translation="MDKRFAVVLAAGQGTRMKSKLYKVLHPVCGKPMVEHVVDEALKLS
FT                   LSKLVTIVGHGAEEVKKQLGDKSEYALQAKQLGTAHAVKQAQPFLADEKGVTIVICGDT
FT                   PLLTAETMEQMLKEHTQREAKATILTAVAEDPTGYGRIIRSENGAVQKIVEHKDASEEE
FT                   RLVTEINTGTYCFDNEALFRAIDQVSNDNAQGEYYLPDVIEILKNEGETVAAYQTGNFQ
FT                   ETLGVNDRVALSQAEQFMKERINKRHMQNGVTLIDPMNTYISPDAVIGSDTVIYPGTVI
FT                   KGEVQIGEDTIIGPHTEIMNSAIGSRTVIKQSVVNHSKVGNDVNIGPFAHIRPDSVIGN
FT                   EVKIGNFVEIKKTQFGDRSKASHLSYVGDAEVGTDVNLGCGSITVNYDGKNKYLTKIED
FT                   GAFIGCNSNLVAPVTVGEGAYVAAGSTVTEDVPGKALAIARARQVNKDDYVKNIHKK"
     atggataagc ggtttgcagt tgttttagcg gctggacaag gaacgagaat gaaatcgaag        60
     ctttataaag tccttcatcc agtttgcggt aagcctatgg tagagcacgt cgtggacgaa       120
     gccttaaaat tatctttatc aaagcttgtc acgattgtcg gacatggtgc ggaagaagtg       180
     aaaaagcagc ttggtgataa aagcgagtac gcgcttcaag caaaacagct tggcactgct       240
     catgctgtaa aacaggcaca gccatttctt gctgacgaaa aaggcgtcac aattgtcatt       300
     tgcggagata cgccgctttt gacagcagag acgatggaac agatgctgaa agaacataca       360
     caaagagaag cgaaagctac gattttaact gcggttgcag aagatccaac tggatacggc       420
     cgcattattc gcagcgaaaa cggagcggtt caaaaaatag ttgagcataa ggacgcctct       480
     gaagaagaac gtcttgtaac tgagatcaac accggtacgt attgttttga caatgaagcg       540
     ctatttcggg ctattgatca ggtgtctaat gataatgcac aaggcgagta ttatttgccg       600
     gatgtcatag agattcttaa aaatgaaggc gaaactgttg ccgcttacca gactggtaat       660
     ttccaagaaa cgctcggagt taatgataga gttgctcttt ctcaggcaga acaatttatg       720
     aaagagcgca ttaataaacg gcatatgcaa aatggcgtga cgttgattga cccgatgaat       780
     acgtatattt ctcctgacgc tgttatcgga agcgatactg tgatttaccc tggaactgtg       840
     attaaaggtg aggtgcaaat cggagaagat acgattattg gccctcatac ggagattatg       900
     aatagtgcca ttggcagccg tacggttatt aaacaatcgg tagtcaatca cagtaaagtg       960
     gggaatgatg taaacatagg accttttgct cacatcagac ctgattctgt catcgggaat      1020
     gaagtgaaga tcgggaattt tgtagaaatt aaaaagactc aattcggaga ccgaagcaag      1080
     gcatctcatc taagctatgt cggcgatgct gaggtaggca ctgatgtaaa cctgggctgc      1140
     ggttcaatta ctgtcaatta tgatggaaag aataagtatt tgacaaaaat tgaagatggc      1200
     gcgtttatcg gctgcaattc caacttggtt gcccctgtca cagtcggaga aggcgcttat      1260
     gtggcggcag gttcaactgt tacggaagat gtacctggaa aagcacttgc tattgccaga      1320
     gcgagacaag taaataaaga cgattatgtg aaaaatattc ataaaaaata a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page