(data stored in SCRATCH zone)

EMBL: AL009126.GLNJ

AL009126.GLNJ        Location/Qualifiers
FT   CDS_pept        265476..266708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnJ"
FT                   /locus_tag="BSU_02440"
FT                   /old_locus_tag="BSU02440"
FT                   /product="two-component sensor histidine kinase [GlnL] for
FT                   glutamine degradation"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 15995196, 17001076,
FT                   21435182, 23461034, 25691471; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02440"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12038"
FT                   /db_xref="GOA:P40758"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG10871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40758"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 15995196, 17001076, 21435182, 23461034,
FT                   25691471"
FT                   /protein_id="CAB12038.2"
FT                   /translation="MLITVPLAGELKFYPLNEEFRVSFGAPVFFFFLSLLRHVPAVLPG
FT                   FLTGAAVFIFRVFLELWGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIM
FT                   LGFIGFMIEVVSDCVELTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYET
FT                   QSREKQTRQQHEHMLMIVSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGR
FT                   ILRLAGEIHEVKKDNQRIFAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQI
FT                   DFYCSIEGEHDEYHVFIVLSIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNG
FT                   PGISEKIGDIVFDPGFTSKYDEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRGVVFAI
FT                   RLPVRHLIQKG"
     atgctgatta cggtgccgct ggccggtgaa ctgaaatttt atcccctcaa tgaagaattc        60
     cgggtcagct ttggggcacc ggtttttttc ttctttttat cattgttgcg gcatgtgccc       120
     gctgtgctgc cgggttttct gactggagcg gctgttttca tctttcgcgt ctttctggaa       180
     ttatggggcg gaggacacaa tgggctgact ccgattctgt atgatcaagc gtctggcttt       240
     ttcttttata tgacttacgc ctgtctgttt tccatattaa aggccaatcg tttccgtgaa       300
     cggccgatta tgctcggttt cattgggttt atgattgaag ttgtgtcaga ttgtgtcgag       360
     ctaactgtgc aatttctcat ttttcatacg gttgtcacgc ctgagaaaat cactgacatt       420
     gcggtgattg cgatttctca cacatttatt gtgatgagct tttatagtgt gctgaagctg       480
     tatgaaacac aatcgagaga aaaacagaca aggcagcagc acgagcacat gctgatgatc       540
     gtttccaatt tatatgaaga aacggtgcac ctaaaaaaga cattgaaaac gacagagaaa       600
     gtgacaaacg attcgtatca gctctatcgg gaaatgaagg gcaaggatgt tcagctgagc       660
     ggcagaatcc tgagactggc cggagagatt catgaagtga aaaaggacaa ccagcggata       720
     ttcgcagggc tttcaaaact gatttcgaat gagagtttga gagattatat gagggcttct       780
     gatttgctgc agctcgtgat tcgaatgaat gaaaagtacg ctgaagcact agggaagcag       840
     attgattttt actgctcgat cgagggagag catgacgaat atcacgtatt tatcgtgctt       900
     tcgatcatta ataatctaac agcaaatgcg gtagaggcta tggatgaaga gggaatggtc       960
     agcctgaggc tccgtaagcc aaatgagagt atggtagaat tccaggtgga agacaatggc      1020
     cccgggattt ccgagaaaat cggagacatt gtgtttgacc cgggctttac ttcaaaatat      1080
     gacgaatttg gcacgccttc tacgggtatc ggactttcct acgtaaagga aatcgtgaca      1140
     gagctagaag gggatatcac gtttgataat cagcagcggg gagtggtgtt tgccatcagg      1200
     ctgcctgtcc ggcatttgat tcagaaaggg tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page