(data stored in SCRATCH zone)

EMBL: AL009126.GLPQA

AL009126.GLPQA       Location/Qualifiers
FT   CDS_pept        complement(233014..233895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQA"
FT                   /locus_tag="BSU_02130"
FT                   /old_locus_tag="BSU02130"
FT                   /product="secreted glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10913081, 21966272; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12007"
FT                   /db_xref="GOA:P37965"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="PDB:5T91"
FT                   /db_xref="PDB:5T9B"
FT                   /db_xref="PDB:5T9C"
FT                   /db_xref="SubtiList:BG10646"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37965"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10913081, 21966272"
FT                   /protein_id="CAB12007.1"
FT                   /translation="MRKNRILALFVLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRG
FT                   ASGYVPEHTILSYETAQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVKDHTL
FT                   ADIKKLDAGSWFNEAYPEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGME
FT                   EKLIASLQKHKLLGKHSKPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDA
FT                   ALEEIKTYAVGAGPDYKALNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTN
FT                   YPDLFHKVKKGY"
     atgagaaaaa atagaatact ggccttgttt gttctgtcgc tgggcttact ctcatttatg        60
     gtaacgccag tgtcggcagc gtcaaaagga aacctgctgt cacctgaccg tatcctgacc       120
     gtcgcgcaca gaggggcttc tggatatgtg cctgagcaca cgattctgtc ttacgaaacc       180
     gctcagaaaa tgaaagctga ttttattgaa ttggatctgc aaatgacaaa agacggaaaa       240
     ttgattgtca tgcatgacga aaaactggac cgcaccacaa acggaatggg ttgggtgaaa       300
     gaccatacgc tcgcagacat taagaagctt gacgccggtt cttggtttaa tgaagcctat       360
     ccggaaaaag caaagccgca gtacgtcggc cttaaagttc ctacattaga agaggtatta       420
     gaccgtttcg gaaagcacgc gaactactac attgaaacaa aatcgcctga cacctaccca       480
     ggtatggaag aaaaactgat cgcttctttg cagaaacata aattactggg aaagcattct       540
     aagccaggcc aggtgatcat tcaatcgttc agcaaagaaa gcctggtaaa agtccatcaa       600
     ttacagccaa acctgccgac cgttcaattg ctggaagcca aacaaatggc gtcaatgaca       660
     gatgctgccc tggaagaaat caaaacatac gctgtcggtg cgggcccgga ttataaagct       720
     ttaaatcaag aaaacgtccg tatgatccgc agccacggcc tcctgcttca tccttacaca       780
     gtcaataatg aagctgatat gcatcgcctg cttgattggg gcgtaacagg agtgttcacc       840
     aactatcctg atcttttcca caaagtaaaa aagggttatt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page