(data stored in ACNUC7421 zone)

EMBL: AL009126.GLSA

AL009126.GLSA        Location/Qualifiers
FT   CDS_pept        complement(264191..265174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA"
FT                   /locus_tag="BSU_02430"
FT                   /old_locus_tag="BSU02430"
FT                   /product="glutaminase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.1.2"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15995196, 18459799, 20050917;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12037"
FT                   /db_xref="GOA:O31465"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="PDB:1MKI"
FT                   /db_xref="PDB:2OSU"
FT                   /db_xref="PDB:3AGF"
FT                   /db_xref="PDB:3BRM"
FT                   /db_xref="SubtiList:BG12753"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31465"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15995196, 18459799, 20050917"
FT                   /protein_id="CAB12037.1"
FT                   /translation="MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVN
FT                   DSQLGICVLEPDGTMIHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGD
FT                   AFNSIIRLEINKPGKPFNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIH
FT                   EEVFRSEWETAHRNRALAYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILA
FT                   HDGYHPIRHEQVIPKDVAKLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPP
FT                   SARREQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELSIF"
     atgaaagaat tgataaaaga gcaccagaaa gacataaacc cggcgttaca gcttcatgat        60
     tgggttgaat actatcgccc ttttgccgcc aatggacaaa gcgcaaacta tatccccgct       120
     ttaggaaaag tcaatgattc acagctcggc atctgtgtat tggagcctga tggaacgatg       180
     atacacgccg gcgactggaa cgtctctttt accatgcaaa gcatttcaaa agtgattagc       240
     tttattgccg cctgcatgag ccgcggcatt ccctatgtgc ttgaccgcgt agatgtcgag       300
     ccgacaggtg acgcctttaa ttcaatcatt cggctcgaaa tcaacaagcc gggaaagccc       360
     ttcaatccca tgatcaacgc gggtgccctc accatcgctt cgatccttcc cggagaatct       420
     gcatacgaaa agctcgagtt tctttactcg gtgatggaaa ctttgatagg aaaacggcca       480
     agaattcatg aagaagtatt ccgttctgaa tgggaaaccg cccaccgcaa cagagcgctg       540
     gcctactatt taaaagaaac aaacttttta gaagctgaag tagaagaaac acttgaggtg       600
     tacttgaagc aatgcgctat ggagagcact acagaagata ttgcgttgat cggcctgatc       660
     cttgctcatg acgggtatca tccgattcga cacgagcagg tgattccaaa agatgtggca       720
     aaattggcca aggcattaat gctgacgtgc ggcatgtaca acgcttcagg caaatatgcg       780
     gcgtttgtcg gcgtgccggc caaaagcggc gtctccggcg gcatcatggc gctggtgcct       840
     ccaagcgcca gaagagaaca gccttttcaa tccggatgcg gcatcggcat ttacgggcct       900
     gccattgatg aatacggcaa cagcctcact ggcggtatgc tgctgaagca tatggcgcag       960
     gaatgggagc tcagcatttt ttaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page