(data stored in SCRATCH zone)

EMBL: AL009126.GLTP

AL009126.GLTP        Location/Qualifiers
FT   CDS_pept        complement(253518..254762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="BSU_02340"
FT                   /old_locus_tag="BSU02340"
FT                   /product="proton/glutamate symport protein"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7751298, 15849754, 16850406;
FT                   Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12028"
FT                   /db_xref="GOA:P39817"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="SubtiList:BG11015"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39817"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7751298, 15849754, 16850406"
FT                   /protein_id="CAB12028.1"
FT                   /translation="MKKLIAFQILIALAVGAVIGHFFPDFGMALRPVGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGSMKKMGSLGIKTIIWFEVITTLVLGLGLLLANVLKPGVGLDLS
FT                   HLAKKDIHELSGYTDKVVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIG
FT                   KASEPVMKFFESTAQIMFKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVF
FT                   LGLFLILFVLFPLVGLIFQIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCP
FT                   KRVVSFVVPSGLSLNCDGSSLYLSVSCIFLAQAFQVDMTLSQQLLMMLVLVMTSKGIAA
FT                   VPSGSLVVLLATANAVGLPAEGVAIIAGVDRVMDMARTGVNVPGHAIACIVVSKWEKAF
FT                   RQKEWVSANSQTESI"
     ttgaaaaaat taatcgcgtt tcaaatttta atcgctttgg ctgtcggcgc ggtgatcggc        60
     cacttttttc ctgatttcgg gatggcactg aggcctgtcg gagatggatt tatccgcctg       120
     attaaaatga ttgttgtgcc gattgtattt tctaccattg tcattggagc cgcaggaagc       180
     ggaagcatga aaaaaatggg cagtctcggc atcaagacga tcatttggtt cgaagtgatt       240
     acaacgttgg tattagggct tggactttta ttagcgaatg tcttaaaacc aggtgtcggg       300
     cttgacctct cccatttggc aaaaaaagat attcatgaac tttccggcta cacagacaaa       360
     gttgttgatt tcaagcaaat gatcctggat attatcccta caaacattat tgatgtcatg       420
     gccagaaatg atttgcttgc cgttattttc ttcgccattt tatttggtgt cgccgcagct       480
     ggtatcggca aagcttctga accagtaatg aagttttttg aatctacagc tcagattatg       540
     ttcaagctca cgcaaatcgt catggtcact gctcctatcg gcgtgttagc cctgatggct       600
     gcttctgtag gccaatatgg cattgaactc ctcctcccta tgtttaagct ggttggcacc       660
     gtattccttg gcctgttcct gatcctcttt gtcctctttc cgcttgtcgg tctcatcttt       720
     cagattaagt atttcgaagt attgaaaatg atatgggatc tgtttttaat tgcattttcc       780
     accacaagca ctgaaaccat tctccctcag ctgatggata gaatggagaa atacggctgt       840
     cccaaacgag tggtatcatt tgtcgttccc tccggcttgt cattgaactg tgacggctcc       900
     agcttatatt tatcggtttc ttgtatcttt ctcgcacagg cctttcaagt agacatgaca       960
     ttgtcccagc agctgctcat gatgcttgtg cttgtgatga ccagtaaagg cattgcagct      1020
     gtaccctcag gatcgcttgt agttcttctg gcgactgcca atgctgtagg actgccggct      1080
     gaaggcgttg ccattatcgc gggtgttgac cgcgtcatgg acatggcgag aacaggcgtg      1140
     aacgtaccgg gacatgcgat cgcctgtatc gtggtatcaa aatgggaaaa ggccttccgc      1200
     caaaaagaat gggtttccgc aaacagccaa actgaaagca tatag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page