(data stored in ACNUC7421 zone)

EMBL: AL009126.GLTX

AL009126.GLTX        Location/Qualifiers
FT   CDS_pept        111047..112498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BSU_00920"
FT                   /old_locus_tag="BSU00920"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.17"
FT                   /EC_number="6.1.1.24"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2120226, 3079749, 9342321,
FT                   10024179, 10546897, 12682299, 14741355; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00920"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11868"
FT                   /db_xref="GOA:P22250"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="SubtiList:BG10154"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22250"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2120226, 3079749, 9342321, 10024179, 10546897,
FT                   12682299, 14741355"
FT                   /protein_id="CAB11868.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARNQGGKFIIRVED
FT                   TDKKRNIEGGEQSQLNYLKWLGIDWDESVDVGGEYGPYRQSERNDIYKVYYEELLEKGL
FT                   AYKCYCTEEELEKEREEQIARGEMPRYSGKHRDLTQEEQEKFIAEGRKPSIRFRVPEGK
FT                   VIAFNDIVKGEISFESDGIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNT
FT                   PKQIMIYQAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEALFNFI
FT                   GLLGWSPVGEEELFTKEQFIEIFDVNRLSKSPALFDMHKLKWVNNQYVKKLDLDQVVEL
FT                   TLPHLQKAGKVGTELSAEEQEWVRKLISLYHEQLSYGAEIVELTDLFFTDEIEYNQEAK
FT                   AVLEEEQVPEVLSTFAAKLEELEEFTPDNIKASIKAVQKETGHKGKKLFMPIRVAVTGQ
FT                   THGPELPQSIELIGKETAIQRLKNI"
     atgggaaacg aagtacgcgt ccgttatgca ccgagtccaa ccggacattt gcatattgga        60
     aatgccagaa cggcgctttt taattattta tttgcccgca atcaaggcgg taagtttatc       120
     attcgagttg aggatactga taaaaagcgc aatattgagg gcggagaaca aagccagctg       180
     aattatctga agtggctagg tattgactgg gatgagagtg tggatgtcgg aggagagtac       240
     ggtccatacc gtcagtcaga gcgtaacgat atctataaag tgtactatga agagcttctt       300
     gaaaaagggc ttgcttataa atgttactgt acggaagaag agcttgaaaa agagcgtgaa       360
     gaacagattg cccgcggaga aatgcctcgt tattccggaa aacacagaga cctgactcag       420
     gaagaacagg agaaatttat cgccgaaggc agaaaaccaa gtattcgttt ccgtgtgccg       480
     gaaggaaaag tcatcgcctt caacgacatc gtaaaaggcg aaatttcttt tgaatcagat       540
     ggcatcggcg acttcgttat tgtgaaaaag gacggaacgc ctacttataa cttcgcggta       600
     gctattgatg actacttaat gaaaatgaca cacgtgctgc gcggtgagga tcatatttct       660
     aacacaccga aacagattat gatctatcaa gcattcgggt gggatattcc tcagttcgga       720
     cacatgacgc tgattgtaaa cgaaagccgt aaaaagctca gcaaacgtga tgaatccatt       780
     attcaattca tcgagcagta caaagagctt ggctacctgc cagaagcgct gttcaacttt       840
     atcggcttgt taggctggtc accggttgga gaagaagagc ttttcacaaa agagcagttt       900
     attgaaattt ttgatgtaaa tcgtttatct aaatcaccag ctttgtttga tatgcataag       960
     ctaaaatggg ttaacaacca atatgtgaag aagctggatc ttgatcaggt tgttgaactg      1020
     acgcttccgc atttgcaaaa agccggcaaa gttggcactg agctttctgc tgaagaacaa      1080
     gaatgggttc gtaaactgat ttccctgtat catgagcaat taagctacgg tgcggaaatt      1140
     gttgagctga ctgatttgtt ctttacggat gagatcgagt ataatcaaga agcgaaagct      1200
     gttctggaag aagaacaggt tcctgaagtg ctcagcacat tcgcagcgaa gcttgaagag      1260
     cttgaggagt tcactccgga taatatcaaa gcatcgatca aagcagtgca gaaagaaact      1320
     ggccataaag ggaaaaaact gtttatgccg attcgtgttg ctgtaacagg gcaaactcac      1380
     ggtccggaac tgccgcaatc aattgaattg atcggtaaag agactgcaat tcagcgttta      1440
     aagaatatct aa                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page