(data stored in ACNUC7421 zone)

EMBL: AL009126.GUAB

AL009126.GUAB        Location/Qualifiers
FT   CDS_pept        15915..17381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BSU_00090"
FT                   /old_locus_tag="BSU00090"
FT                   /product="inosine-monophosphate dehydrogenase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="1.1.1.205"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 1722815, 17611193,
FT                   1979163, 3125411, 8917437; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00090"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11785"
FT                   /db_xref="GOA:P21879"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="SubtiList:BG10073"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21879"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 1722815, 17611193, 1979163, 3125411,
FT                   8917437"
FT                   /protein_id="CAB11785.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTKTLKLNIP
FT                   VISAGMDTVTESAMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   DHQVFDAEHLMGKYRISGVPIVNNEEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TASVGTTLDEAEKILQKHKIEKLPLVDDQNKLKGLITIKDIEKVIEFPNSSKDIHGRLI
FT                   VGAAVGVTGDTMTRVKKLVEANVDVIVIDTAHGHSQGVLNTVTKIRETYPELNIIAGNV
FT                   ATAEATRALIEAGADVVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKTIIA
FT                   DGGIKFSGDITKALAAGGHAVMLGSLLAGTSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEENKKFVPEGIEGRTPYKGPVEETVYQLVGGLRSGMGYCGSKDLRALREEA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
     atgtgggaaa gtaaattttc aaaagaaggc ttaacgttcg acgatgtgct gcttgtacca        60
     gcaaagtctg aggtacttcc gcgtgatgtg gatttatctg tagaacttac aaaaacgtta       120
     aagctaaata ttcctgtcat cagcgcaggt atggacactg taacagaatc agcaatggca       180
     attgcaatgg caagacaggg cggcttgggc atcattcaca aaaatatgtc cattgaacag       240
     caggctgaac aagttgataa agtaaagcgt tctgagcgcg gcgttatcac aaatcccttc       300
     tttttaactc ctgatcacca agtatttgat gcggagcatt tgatggggaa atacagaatt       360
     tccggtgttc cgattgtaaa taacgaagaa gaccagaagc ttgttggaat tattacaaac       420
     cgtgaccttc gttttatttc tgactactca atgaaaatca gcgacgtcat gacgaaagaa       480
     gagctagtta ctgcatctgt aggaactact ctggatgaag ctgaaaagat tttgcagaaa       540
     cataaaattg aaaagcttcc tctcgtagat gaccagaata aattaaaagg tcttatcaca       600
     attaaagaca ttgaaaaagt cattgagttc ccgaactcat ctaaagacat tcacggccgc       660
     ctgatcgttg gcgcggcagt tggtgtaact ggcgatacaa tgactcgcgt caaaaagctt       720
     gttgaagcca atgttgatgt gattgttatc gatacagctc acggacactc tcaaggcgtt       780
     ttaaacacag tcacaaaaat ccgtgaaacg tatcccgaat taaacattat tgctggaaac       840
     gtggcaacag ctgaagcgac aagagcgctt atcgaagctg gagcagacgt tgtcaaagtt       900
     ggaatagggc ctggttcaat ttgtactaca cgtgttgtag ccggcgtggg tgttccgcaa       960
     attacagcaa tttatgattg tgcgactgaa gcaagaaaac acggcaaaac aatcatcgcc      1020
     gacggtggga ttaaattctc tggcgatatc actaaagcat tggcagccgg cggacatgct      1080
     gttatgctcg gaagcttgct tgcaggcaca tcagaaagcc ctggtgaaac tgaaatctac      1140
     caaggcagaa gatttaaggt ataccgcggc atgggatcag ttgctgcaat ggaaaaagga      1200
     agtaaagacc gttacttcca agaagaaaac aaaaaatttg ttcctgaagg aattgaagga      1260
     cgcacacctt acaaagggcc agttgaagaa accgtttatc agctagtcgg aggccttcgt      1320
     tctggtatgg ggtattgcgg gtccaaagat ctgcgtgcgc taagagaaga agctcagttc      1380
     attcgcatga ctggcgcagg acttcgcgaa agccatccgc atgacgtaca gattacaaaa      1440
     gaatcaccta actatacaat ttcataa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page