(data stored in ACNUC7421 zone)

EMBL: AL009126.GUCD

AL009126.GUCD        Location/Qualifiers
FT   CDS_pept        268846..270312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gucD"
FT                   /locus_tag="BSU_02470"
FT                   /old_locus_tag="BSU02470"
FT                   /product="2,5-dioxovalerate dehydrogenase
FT                   (alpha-ketoglutaric semialdehyde dehydrogenase)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.26"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12044674, 17202142; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12041"
FT                   /db_xref="GOA:P42236"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="SubtiList:BG11159"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42236"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12041.1"
FT                   /translation="MSVITEQNTYLNFINGEWVKSQSGDMVKVENPADVNDIVGYVQNS
FT                   TAEDVERAVTAANEAKTAWRKLTGAERGQYLYKTADIMEQRLEEIAACATREMGKTLPE
FT                   AKGETARGIAILRYYAGEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIP
FT                   IWKMAPALVYGNTVVIKPATETAVTCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAE
FT                   HDGVNAVTFTGSNQVGKIIGQAALARGAKYQLEMGGKNPVIVADDADLEAAAEAVITGA
FT                   FRSTGQKCTATSRVIVQSGIYERFKEKLLQRTKDITIGDSLKEDVWMGPIASKNQLDNC
FT                   LSYIEKGKQEGASLLIGGEKLENGKYQNGYYVQPAIFDNVTSEMTIAQEEIFGPVIALI
FT                   KVDSIEEALNIANDVKFGLSASIFTENIGRMLSFIDEIDAGLVRINAESAGVELQAPFG
FT                   GMKQSSSHSREQGEAAKDFFTAIKTVFVKP"
     atgtctgtga tcacggaaca aaacacgtac ctcaacttta ttaacggaga gtgggttaag        60
     tctcaatcag gcgatatggt caaagtcgaa aaccctgccg atgtgaatga tattgtcgga       120
     tatgtacaga attcaacggc tgaagatgtg gaacgtgccg tcaccgccgc caatgaagcc       180
     aaaacggctt ggagaaagct gacgggtgcc gagcgcggcc aatacttata caaaacagcg       240
     gatatcatgg agcagcgctt ggaggaaatc gccgcctgtg caacgcgtga aatgggtaaa       300
     acattgccgg aagcgaaggg agaaacagcc cgggggattg ccattctgcg ctattacgcc       360
     ggagagggca tgcgaaaaac gggtgacgtc attccgtcta ctgacaaaga cgcgctcatg       420
     tttaccaccc gtgttccgct cggtgtggtc ggtgtgattt ctccgtggaa cttcccagtg       480
     gcgattccga tttggaaaat ggcgccggca ttggtatacg gcaataccgt tgtcatcaaa       540
     ccggcgacag aaacagctgt gacatgcgcg aagatcattg cctgctttga ggaagcgggg       600
     ctcccggcag gggtcatcaa tttggtgaca ggcccgggtt ctgttgtcgg gcaggggctt       660
     gctgagcatg acggtgtaaa cgccgttacg tttaccggtt caaatcaagt cggaaaaatc       720
     atcgggcaag ccgctttagc gaggggagcc aaatatcagc ttgagatggg cggcaaaaac       780
     cctgtcatcg tagctgatga cgctgacctt gaagctgcgg cagaagctgt cataacgggg       840
     gccttccgtt caaccggcca gaaatgcacc gcgacaagcc gtgtcatcgt acaaagcgga       900
     atttacgagc gctttaaaga aaaactgctc cagcgcacaa aagatattac aatcggagac       960
     agcttaaaag aggatgtctg gatgggaccg atagccagca agaatcagct tgataactgc      1020
     ctgtcataca ttgagaaagg caaacaggag ggcgcttccc ttttaatagg aggagaaaag      1080
     ctggagaacg gaaagtatca aaacggctat tatgttcagc ctgccatctt tgacaatgtg      1140
     acatctgaga tgacaattgc ccaggaggaa attttcggtc cggtgatcgc cttgatcaag      1200
     gtggactcga tagaggaggc gctgaacatc gccaatgatg tgaagttcgg tttaagtgca      1260
     tccatcttca cggaaaacat cggccgaatg ctttctttca ttgatgaaat cgatgccggg      1320
     ctggttcgga tcaatgcaga aagcgcaggt gttgagctgc aggcgccttt tggcggcatg      1380
     aagcagtcga gctcccactc ccgagaacag ggtgaggcag cgaaggactt tttcacagcg      1440
     atcaaaactg tttttgtgaa gccgtaa                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page