(data stored in ACNUC7421 zone)

EMBL: AL009126.GUDD

AL009126.GUDD        Location/Qualifiers
FT   CDS_pept        271800..273167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gudD"
FT                   /locus_tag="BSU_02490"
FT                   /old_locus_tag="BSU02490"
FT                   /product="glucarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.40"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9772161, 12044674; Product type
FT                   e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12043"
FT                   /db_xref="GOA:P42238"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="SubtiList:BG11161"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42238"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12043.2"
FT                   /translation="MSSPIQEQVQKEKRSNIPSISEMKVIPVAGHDSMLLNLSGAHSPF
FT                   FTRNIVILTDSSGNQGVGEVPGGEHIRRTLELSEPLVVGKSIGAYQAILQTVRKQFGDQ
FT                   DRGGRGNQTFDLRTTVHAVTALEAALLDLLGKFLQEPVAALLGEGKQRDEVKMLGYLFY
FT                   IGDRNRTTLPYQSDEQSDCAWFRLRHEEALTPEAIVRLAESAQERYGFQDFKLKGGVLR
FT                   GEEEIEAVTALSKRFPEARITLDPNGAWSLEEAIALCKGKQDVLAYAEDPCGDENGYSA
FT                   REVMAEFRRATGLPTATNMIATDWREMGHAIQLHAVDIPLADPHFWTMQGSVRVAQMCH
FT                   DWGLTWGSHSNNHFDISLAMFTHVAAAAPGRITAIDTHWIWQDGQRLTKQPFEISSGCV
FT                   KVPDKPGLGVDIDMEQVEKAHEIYRKMNLGARNDAIPMQFLISNWEFDRKRPCLVR"
     atgagttcac cgatacaaga gcaggttcaa aaagaaaaaa gatcgaatat tccctcaatt        60
     tctgaaatga aggtgattcc tgttgcggga catgacagca tgctgctgaa tctaagcgga       120
     gcacacagcc cgttttttac ccggaatatc gtaatcttaa cagacagcag cggaaatcag       180
     ggagtcggcg aggtgcctgg cggagagcat attcgccgca cactggagct gtcagagccg       240
     cttgttgtcg gaaaatctat cggtgcgtac caggcgatat tgcaaacggt cagaaagcag       300
     tttggcgatc aggacagggg agggcgagga aaccagacgt ttgatttgcg caccactgtg       360
     cacgccgtca ccgcactgga agcggctttg ttggatttgc ttggaaagtt tcttcaggaa       420
     ccggtcgcgg ctttgctggg cgaagggaag cagcgtgatg aagtaaaaat gctcggttac       480
     ctcttttaca tcggcgaccg aaatcggacg accttgccgt atcaaagcga tgagcagtca       540
     gattgtgcgt ggttccgtct gcgccatgag gaagcgctga cgccggaggc cattgtgcgt       600
     cttgccgaat ccgcacagga gcgctatggc tttcaggatt tcaaattgaa aggcggggtg       660
     ctgcggggag aagaggaaat cgaagctgtt accgcattat cgaaacgttt tccagaggca       720
     aggatcactc ttgatccgaa cggggcatgg tcattagagg aagctattgc attatgcaaa       780
     ggaaagcaag atgtgctcgc gtatgcggaa gatccatgcg gggatgagaa tggctactcc       840
     gctcgtgaag taatggctga attccgccgc gcgacagggc ttccgactgc gacaaatatg       900
     attgcgactg actggcggga aatgggtcac gcgattcagc tccacgcggt cgatataccg       960
     ctggctgatc cgcatttttg gacgatgcaa gggtcggtgc gggttgcgca aatgtgccat      1020
     gattggggtt tgacatgggg ctcgcactcc aacaaccact ttgatatttc ccttgcgatg      1080
     tttacccatg tggcagcagc ggctccgggg cggatcacgg cgattgatac ccattggatc      1140
     tggcaggacg ggcagcgatt aacgaaacag ccttttgaga tttcttctgg ctgtgtcaag      1200
     gtgccggata agcctggact aggcgtcgat attgatatgg aacaagtgga aaaagcgcat      1260
     gagatctatc ggaaaatgaa tttaggcgca cggaatgatg cgatcccaat gcagttcctg      1320
     atcagcaact gggaatttga ccggaagcgc ccgtgtcttg tgcgataa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page