(data stored in ACNUC7421 zone)

EMBL: AL009126.GYRA

AL009126.GYRA        Location/Qualifiers
FT   CDS_pept        6994..9459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BSU_00070"
FT                   /old_locus_tag="BSU00070"
FT                   /product="DNA gyrase (subunit A)"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 12767818, 17320901,
FT                   27557712; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00070"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11783"
FT                   /db_xref="GOA:P05653"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="PDB:4DDQ"
FT                   /db_xref="SubtiList:BG10071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05653"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 12767818, 17320901, 27557712"
FT                   /protein_id="CAB11783.1"
FT                   /translation="MSEQNTPQVREINISQEMRTSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKPYKKSARIVGEVIGKYHPHGDSAVYESMVRMAQDFNYRYMLV
FT                   DGHGNFGSVDGDSAAAMRYTEARMSKISMEILRDITKDTIDYQDNYDGSEREPVVMPSR
FT                   FPNLLVNGAAGIAVGMATNIPPHQLGEIIDGVLAVSENPDITIPELMEVIPGPDFPTAG
FT                   QILGRSGIRKAYESGRGSITIRAKAEIEQTSSGKERIIVTELPYQVNKAKLIEKIADLV
FT                   RDKKIEGITDLRDESDRTGMRIVIEIRRDANANVILNNLYKQTALQTSFGINLLALVDG
FT                   QPKVLTLKQCLEHYLDHQKVVIRRRTAYELRKAEARAHILEGLRVALDHLDAVISLIRN
FT                   SQTAEIARTGLIEQFSLTEKQAQAILDMRLQRLTGLEREKIEEEYQSLVKLIAELKDIL
FT                   ANEYKVLEIIREELTEIKERFNDERRTEIVTSGLETIEDEDLIERENIVVTLTHNGYVK
FT                   RLPASTYRSQKRGGKGVQGMGTNEDDFVEHLISTSTHDTILFFSNKGKVYRAKGYEIPE
FT                   YGRTAKGIPIINLLEVEKGEWINAIIPVTEFNAELYLFFTTKHGVSKRTSLSQFANIRN
FT                   NGLIALSLREDDELMGVRLTDGTKQIIIGTKNGLLIRFPETDVREMGRTAAGVKGITLT
FT                   DDDVVVGMEILEEESHVLIVTEKGYGKRTPAEEYRTQSRGGKGLKTAKITENNGQLVAV
FT                   KATKGEEDLMIITASGVLIRMDINDISITGRVTQGVRLIRMAEEEHVATVALVEKNEED
FT                   ENEEEQEEV"
     atgagtgaac aaaacacacc acaagttcgt gaaataaata tcagtcagga aatgcgtacg        60
     tccttcttgg attatgcaat gagcgttatc gtgtcccgtg ctcttccgga tgttcgtgac       120
     ggtttaaaac cggttcatag acggattttg tatgcaatga atgatttagg catgacaagt       180
     gacaagcctt ataaaaaatc cgcgcgtatc gttggagaag ttatcgggaa ataccacccg       240
     cacggtgatt cagcggtata tgaatccatg gtcagaatgg ctcaggattt caactaccgt       300
     tatatgctcg ttgacggtca cggaaacttc ggttctgttg acggagactc agcggcggcc       360
     atgcgttata cagaagcacg aatgtctaaa atctcaatgg agattcttcg cgacatcaca       420
     aaagacacaa tcgattacca ggataactat gacgggtcag aaagagaacc tgtcgttatg       480
     ccttcaaggt tcccgaatct gctcgtgaac ggtgctgccg gcattgcggt aggtatggca       540
     acaaacattc ctccgcacca gctgggagaa atcattgacg gtgtacttgc tgttagtgag       600
     aatccggaca ttacaattcc agagcttatg gaagtcattc cagggcctga tttcccgacc       660
     gcgggtcaaa tcttgggacg cagcggtatc cggaaagcat acgaatcagg ccgaggctct       720
     atcacgatcc gggcaaaagc tgagatcgaa caaacatctt cgggtaaaga aagaattatc       780
     gttacagagt taccttacca agtaaataag gcgaaattaa ttgagaaaat tgctgatctc       840
     gtaagggaca aaaagataga gggtatcaca gatctgcgtg atgagtcaga tcgtacaggt       900
     atgagaattg tcattgaaat cagacgcgat gccaatgcga atgttatctt aaacaatctg       960
     tacaaacaaa ctgctctaca aacatctttt ggcatcaacc tgcttgcgct tgttgatggc      1020
     cagccgaaag ttttaactct taagcaatgc ctggagcatt accttgacca tcaaaaagtt      1080
     gtcattagac gccgtactgc ttatgaattg cgtaaagcag aagcgagagc tcatatcttg      1140
     gaaggattga gagttgcact ggatcatctc gatgcagtta tctcccttat ccgtaattct      1200
     caaacggctg aaattgcgag aacaggttta attgaacaat tctcactgac agagaagcaa      1260
     gcacaagcga tccttgacat gaggctccag cgtttaacgg gactggaacg tgaaaagatc      1320
     gaagaagaat accagtctct tgttaaatta attgcagagc taaaagacat cttggcaaat      1380
     gaatataaag tgcttgagat cattcgtgaa gaactcacgg aaatcaaaga gcgttttaac      1440
     gatgaaagac gtactgagat cgtcacttct ggactggaga caattgaaga tgaagatctc      1500
     atcgagagag aaaatatcgt agttactctg acgcacaacg gatacgtcaa acgtcttcct      1560
     gcatcaactt accgcagtca aaaacggggc ggaaaaggtg tacaaggtat gggaacaaac      1620
     gaagatgatt tcgttgaaca tttgatctct acgtcaactc atgacacgat tctcttcttc      1680
     tcgaacaagg ggaaagtgta tcgtgcaaaa gggtatgaaa tccctgaata cggcagaacg      1740
     gcaaaaggaa tcccgattat taacctgctg gaggtagaaa agggtgagtg gatcaacgcg      1800
     attattccag tcacggaatt caatgcggag ctttacctct tcttcactac aaagcatggg      1860
     gtttcaaaac gaacatcgct atctcaattc gctaatatcc gcaacaatgg tctaattgct      1920
     ctgagtcttc gtgaagatga tgaactgatg ggtgtacgtc tgactgacgg cacaaaacaa      1980
     atcatcattg gaacgaaaaa cggtttactg attcgtttcc ctgaaacaga tgtccgagag      2040
     atgggaagaa ctgcggcggg cgtaaaaggc atcaccctga cggatgacga cgttgttgtc      2100
     ggcatggaga ttttagagga agaatcacac gtccttatcg taactgaaaa agggtacgga      2160
     aaacgaactc ctgctgaaga gtacagaacc caaagccggg gcggaaaagg actcaaaaca      2220
     gcgaaaatca ccgagaacaa cggccaacta gtagcagtga aagctactaa aggtgaagag      2280
     gatctaatga ttattacagc tagcggcgta ctcatcagaa tggacatcaa tgatatctcc      2340
     atcaccggac gtgtcactca aggtgtgcgt ctcatcagaa tggcagaaga agagcatgtt      2400
     gctacagtag ctttagttga gaaaaacgaa gaagatgaga atgaagaaga acaagaagaa      2460
     gtgtga                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page