(data stored in SCRATCH zone)

EMBL: AL009126.GYRB

AL009126.GYRB        Location/Qualifiers
FT   CDS_pept        4867..6783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BSU_00060"
FT                   /old_locus_tag="BSU00060"
FT                   /product="DNA gyrase (subunit B)"
FT                   /function="16.9: Replicate"
FT                   /function="16.3: Control"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 12767818, 17320901;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11782"
FT                   /db_xref="GOA:P05652"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG10070"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05652"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 12767818, 17320901"
FT                   /protein_id="CAB11782.1"
FT                   /translation="MEQQQNSYDENQIQVLEGLEAVRKRPGMYIGSTNSKGLHHLVWEI
FT                   VDNSIDEALAGYCTDINIQIEKDNSITVVDNGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFDGSGYKVSGGLHGVGASVVNALSTELDVTVHRDGKIHRQTYKRGVPVTDLEIIGETD
FT                   HTGTTTHFVPDPEIFSETTEYDYDLLANRVRELAFLTKGVNITIEDKREGQERKNEYHY
FT                   EGGIKSYVEYLNRSKEVVHEEPIYIEGEKDGITVEVALQYNDSYTSNIYSFTNNINTYE
FT                   GGTHEAGFKTGLTRVINDYARKKGLIKENDPNLSGDDVREGLTAIISIKHPDPQFEGQT
FT                   KTKLGNSEARTITDTLFSTAMETFMLENPDAAKKIVDKGLMAARARMAAKKARELTRRK
FT                   SALEISNLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFF
FT                   YRYMRQIIENGYVYIAQPPLYKVQQGKRVEYAYNDKELEELLKTLPQTPKPGLQRYKGL
FT                   GEMNATQLWETTMDPSSRTLLQVTLEDAMDADETFEMLMGDKVEPRRNFIEANARYVKN
FT                   LDI"
     atggaacagc agcaaaacag ttatgatgaa aatcagatac aggtactaga aggattggaa        60
     gctgttcgta aaagaccggg gatgtatatc ggttcgacaa acagcaaagg ccttcaccac       120
     ttggtatggg aaattgtcga caatagtatt gacgaagccc tcgccggtta ttgtacggat       180
     atcaatatcc aaatcgaaaa agacaacagt atcacggttg tagataatgg ccgcggtatt       240
     ccagtcggta ttcatgaaaa aatgggccgt cctgcggtag aagtcattat gacggtgctt       300
     catgccggag gaaaatttga cggaagcggc tataaagtat ccggaggatt acacggtgta       360
     ggtgcgtcgg tcgtaaacgc actatcaaca gagcttgatg tgacggttca ccgtgacggt       420
     aaaattcacc gccaaaccta taaacgcgga gttccggtta cagaccttga aatcattggc       480
     gaaacggatc atacaggaac gacgacacat tttgtcccgg accctgaaat tttctcagaa       540
     acaaccgagt atgattacga tctgcttgcc aaccgcgtgc gtgaattagc ctttttaaca       600
     aagggcgtaa acatcacgat tgaagataaa cgtgaaggac aagagcgcaa aaatgaatac       660
     cattacgaag gcggaattaa aagttatgta gagtatttaa accgctctaa agaggttgtc       720
     catgaagagc cgatttacat tgaaggcgaa aaggacggca ttacggttga agtggctttg       780
     caatacaatg acagctacac aagcaacatt tactcgttta caaacaacat taacacgtac       840
     gaaggcggta cccatgaagc tggcttcaaa acgggcctga ctcgtgttat caacgattac       900
     gccagaaaaa aagggcttat taaagaaaat gatccaaacc taagcggaga tgacgtaagg       960
     gaagggctga cagcgattat ttcaatcaaa caccctgatc cgcagtttga gggccaaaca      1020
     aaaacaaagc tgggcaactc agaagcacgg acgatcaccg atacgttatt ttctacggcg      1080
     atggaaacat ttatgctgga aaatccagat gcagccaaaa aaattgtcga taaaggttta      1140
     atggcggcaa gagcaagaat ggctgcgaaa aaagcgcgtg aactaacacg ccgtaagagt      1200
     gctttggaaa tttcaaacct gcccggtaag ttagcggact gctcttcaaa agatccgagc      1260
     atctccgagt tatatatcgt agagggtgac tctgccggag gatctgctaa acaaggacgc      1320
     gacagacatt tccaagccat tttgccgctt agaggtaaaa tcctaaacgt tgaaaaggcc      1380
     agactggata aaatcctttc taacaacgaa gttcgctcta tgatcacagc gctcggcaca      1440
     ggtatcggag aagacttcaa ccttgagaaa gcccgttacc acaaagttgt cattatgaca      1500
     gatgccgatg ttgacggcgc gcacatcaga acactgctgt taacgttctt ttacagatat      1560
     atgcgccaaa ttatcgaaaa tggctacgtg tacattgcgc agccgccgct ctacaaggtt      1620
     caacagggga aacgcgttga atatgcatac aatgacaagg agcttgaaga gctgttaaaa      1680
     actcttcctc aaacgcctaa gcctggactg cagcgttaca aaggtcttgg tgaaatgaat      1740
     gccacccagc tatgggagac aaccatggat cctagctcca gaacacttct tcaggtaact      1800
     cttgaagatg caatggatgc ggatgagact tttgaaatgc ttatgggcga caaggtagaa      1860
     ccgcgccgaa acttcataga agcgaatgcg agatacgtta aaaatcttga catctaa         1917
//

If you have problems or comments...

PBIL Back to PBIL home page