(data stored in ACNUC7421 zone)

EMBL: AL009126.HOLB

AL009126.HOLB        Location/Qualifiers
FT   CDS_pept        40665..41654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BSU_00310"
FT                   /old_locus_tag="BSU00310"
FT                   /product="DNA polymerase III clamp loader delta' subunit"
FT                   /function="16.9: Replicate"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8509334, 12060778, 12682299,
FT                   22333191, 23525462; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00310"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11807"
FT                   /db_xref="GOA:P37540"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG10095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37540"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8509334, 12060778, 12682299, 22333191, 23525462"
FT                   /protein_id="CAB11807.1"
FT                   /translation="MAISWKEMNELQPRVMKLLYNSIEKDRLSHAYLFEGKKGTGKLDA
FT                   ALLLAKSFFCLEGGAEPCESCRNCKRIESGNHPDLHLVQPDGLSIKKAQIQALQEEFSK
FT                   TGLESHKKLYIISHADQMTANAANSLLKFLEEPNKDTMAVLITEQPQRLLDTIISRCQT
FT                   LPFQPLQPKAIEDRLIEQDVSPHMARLLANMTNNVAEAVELSRNDEFAESRAKVIKLYE
FT                   VLHQRKGHAFFFIQDQWMPFFKEKTHQEMGLDMLLLIYRDVLSIQIGNEDKLIYQDLFQ
FT                   SIKQHALQSTQQSVTNQILAVLEAKKRLHSNVNVQGLMEHLVLMLQEG"
     atggcaatat cctggaagga aatgaacgag cttcagccca gagtgatgaa gcttttatat        60
     aatagtattg agaaggacag actatcacac gcttatttgt ttgaggggaa aaaaggaaca       120
     ggcaagcttg atgccgcgct gcttcttgca aaaagcttct tttgtctgga gggtggcgcg       180
     gagccttgtg agagctgccg aaactgtaaa cggatagagt cagggaacca tcctgatctc       240
     catcttgttc agcctgatgg cttatcaatc aaaaaggcgc aaattcaagc gctccaagaa       300
     gagttttcta agacaggact tgaatcgcat aaaaagctgt atattatttc gcacgcagat       360
     caaatgacag caaatgcggc gaacagcctg ctgaaatttt tagaagaacc gaacaaagac       420
     acaatggccg tcctcatcac tgagcagccc caaaggttat tggataccat catttcaaga       480
     tgccaaaccc ttccttttca gcctttgcag ccgaaagcaa ttgaagacag actgatcgaa       540
     caggacgtct cgcctcatat ggcaaggctt ctggccaaca tgactaataa tgtagcagaa       600
     gcagtcgaat taagtcgaaa tgatgagttt gcagagtcta gagcgaaagt gataaaattg       660
     tatgaagtcc tacaccagcg gaaaggacat gcttttttct ttattcaaga tcaatggatg       720
     ccctttttca aagaaaaaac ccatcaagaa atgggtcttg atatgctctt attgatatat       780
     cgtgatgtgt tgtccatcca aataggaaat gaagataaat tgatttatca agacttattc       840
     caatcaataa aacagcatgc gctacaatca acacaacaaa gcgttacgaa tcagatactt       900
     gctgttttag aagcaaagaa acggcttcat tccaatgtga atgtacaagg attaatggag       960
     cacttggtgt taatgttgca ggagggataa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page