(data stored in ACNUC7421 zone)

EMBL: AL009126.HPRT

AL009126.HPRT        Location/Qualifiers
FT   CDS_pept        76344..76886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BSU_00680"
FT                   /old_locus_tag="BSU00680"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.4.2.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 3110131, 6408059, 24001521;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11844"
FT                   /db_xref="GOA:P37472"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="SubtiList:BG10131"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37472"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:3110131, 6408059, 24001521"
FT                   /protein_id="CAB11844.1"
FT                   /translation="MMKHDIEKVLISEEEIQKKVKELGAELTSEYQDTFPLAIGVLKGA
FT                   LPFMADLIKHIDTYLEMDFMDVSSYGNSTVSSGEVKIIKDLDTSVEGRDILIIEDIIDS
FT                   GLTLSYLVELFRYRKAKSIKIVTLLDKPSGRKADIKADFVGFEVPDAFVVGYGLDYAER
FT                   YRNLPYIGVLKPAVYES"
     atgatgaaac atgatatcga gaaagtactg atctcagagg aagagataca aaagaaagta        60
     aaagagttag gtgcagaatt aacgagcgag tatcaagata catttccgtt ggcaatcggt       120
     gtgttaaaag gagcacttcc ttttatggcg gatcttatca agcatattga tacatatttg       180
     gaaatggatt tcatggatgt atcaagctac ggaaattcta cggtttcttc tggagaagta       240
     aaaatcatta aagatttgga tacatctgta gagggccggg acatcttaat tattgaagat       300
     atcatcgaca gtgggttaac cttaagttat ctcgtagagc tcttccgata ccgtaaagca       360
     aaatcaatta agattgttac ccttttggat aaaccgagcg gaagaaaagc ggacatcaaa       420
     gcagactttg tcggttttga agttcctgac gcgtttgtag tgggttacgg acttgattat       480
     gctgagcgct atcgcaatct gccttatatc ggagtgttaa aaccggcagt ttatgaaagc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page