(data stored in ACNUC7421 zone)

EMBL: AL009126.HSLO

AL009126.HSLO        Location/Qualifiers
FT   CDS_pept        79880..80755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BSU_00710"
FT                   /old_locus_tag="BSU00710"
FT                   /product="disulfide bond chaperone (heat shock protein
FT                   HSP33)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11323724, 15023991; Product type
FT                   f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00710"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11847"
FT                   /db_xref="GOA:P37565"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="PDB:1VZY"
FT                   /db_xref="SubtiList:BG10134"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37565"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11847.1"
FT                   /translation="MDYLVKALAYDGKVRAYAARTTDMVNEGQRRHGTWPTASAALGRT
FT                   MTASLMLGAMLKGDDKLTVKIEGGGPIGAIVADANAKGEVRAYVSNPQVHFDLNEQGKL
FT                   DVRRAVGTNGTLSVVKDLGLREFFTGQVEIVSGELGDDFTYYLVSSEQVPSSVGVGVLV
FT                   NPDNTILAAGGFIIQLMPGTDDETITKIEQRLSQVEPISKLIQKGLTPEEILEEVLGEK
FT                   PEILETMPVRFHCPCSKERFETAILGLGKKEIQDMIEEDGQAEAVCHFCNEKYLFTKEE
FT                   LEGLRDQTTR"
     atggattatt tagtaaaagc acttgcgtat gacggaaaag ttcgggctta tgcagcgaga        60
     acgactgata tggtaaatga ggggcagaga cgccatggta cgtggccgac agcatccgct       120
     gcactaggcc gtacaatgac agcttcactt atgctcggcg ctatgctgaa gggcgatgat       180
     aagctgaccg tgaaaatcga gggcggaggt ccgatcggag ctattgtagc tgatgccaat       240
     gccaaaggag aagtcagagc ctatgtctct aacccgcaag ttcattttga tttaaatgaa       300
     caaggtaagc ttgatgtcag acgtgcggtt ggaacaaacg gaacgttaag tgtcgtaaaa       360
     gatttaggtt tgcgcgagtt cttcacagga caagtagaaa tcgtttcagg agaattagga       420
     gatgatttta cttactatct tgtgtcatct gagcaggttc cttcatcagt gggcgtaggt       480
     gtgctcgtaa atcctgacaa taccattctt gcggcagggg gctttattat tcagctgatg       540
     ccgggaacag atgatgaaac aatcacaaaa attgaacagc gtctatctca agtagagccg       600
     atttctaagc tcatccaaaa agggctgaca ccagaagaaa ttttagaaga agtcctaggc       660
     gagaaacctg agattttgga aacgatgcct gtcagattcc attgcccttg ttcaaaagaa       720
     cggttcgaaa cagccatttt aggactaggc aaaaaagaaa ttcaagatat gatagaagaa       780
     gatggacaag ccgaagcagt atgccatttt tgtaatgaaa agtacttatt tacaaaagaa       840
     gagctggaag ggcttcgtga ccaaactacc cgctaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page