(data stored in ACNUC7421 zone)

EMBL: AL009126.HSLR

AL009126.HSLR        Location/Qualifiers
FT   CDS_pept        67877..68137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslR"
FT                   /locus_tag="BSU_00590"
FT                   /old_locus_tag="BSU00590"
FT                   /product="ribosomal RNA binding protein involved in 50S
FT                   recycling; heat shock protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10675343, 10675344, 19013177;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00590"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11835"
FT                   /db_xref="GOA:P37557"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="SubtiList:BG10122"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37557"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11835.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAKASSDVKPGD
FT                   ELTVRFGQKLVTVQVNELKDTTKKEEAANMYTILKEEKLGE"
     atgagattag ataaattttt gaaagtatca cggctgatca aacggcgtac actagcgaag        60
     gaagtagctg accaaggacg aatctctatt aacggaaacc aagctaaagc tagctctgac       120
     gtaaaaccgg gagatgaact aacggtccgc ttcggccaaa agcttgtaac ggttcaagtt       180
     aatgaattga aagacacgac gaaaaaagaa gaagctgcaa acatgtacac gattctaaaa       240
     gaagaaaaac tcggcgaata g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page