(data stored in ACNUC7421 zone)

EMBL: AL009126.HXLA

AL009126.HXLA        Location/Qualifiers
FT   CDS_pept        complement(375166..375798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlA"
FT                   /locus_tag="BSU_03460"
FT                   /old_locus_tag="BSU03460"
FT                   /product="3-hexulose-6-phosphate synthase (HPS)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="4.1.2.43"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10572115, 15978081; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12140"
FT                   /db_xref="GOA:P42405"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="SubtiList:BG11183"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42405"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10572115, 15978081"
FT                   /protein_id="CAB12140.1"
FT                   /translation="MELQLALDLVNIPEAIELVKEVEQYIDVVEIGTPVVINEGLRAVK
FT                   EIKEAFPQLKVLADLKIMDAGGYEIMKASEAGADIITVLGATDDATIKGAVEEAKKQKK
FT                   KILVDMINVKDIESRAKEIDALGVDYICVHTGYDLQAEGKNSFEELTTIKNTVKNAKTA
FT                   IAGGIKLDTLPEVIQQKPDLVIVGGGITSAADKAETASKMKQLIVQG"
     atggaattac agcttgcatt agacctcgtc aacatcccgg aagccattga gcttgtcaaa        60
     gaggtagaac aatacatcga cgtagttgaa atcggaacac cggtcgtcat caatgaaggc       120
     ctaagagccg ttaaagaaat aaaagaagca tttcctcaat tgaaggttct tgcagacctg       180
     aaaatcatgg atgccggagg ctacgaaatt atgaaagcgt cggaagcagg cgctgacatc       240
     atcaccgttt taggggctac agacgatgca acgattaaag gcgcagtaga agaagccaaa       300
     aaacaaaaga agaaaatctt agtggacatg attaacgtga aagatatcga atcccgtgcg       360
     aaagaaattg acgcactcgg tgttgactac atctgcgtcc acactggcta tgatcttcaa       420
     gcagagggca aaaactcttt cgaagaatta acgacaatca aaaataccgt aaaaaacgca       480
     aaaaccgcaa tcgcgggcgg catcaaactt gatacactgc cagaagtgat ccagcaaaag       540
     cctgaccttg tcattgtcgg gggcggaatt acaagcgcag ctgataaggc ggaaacagct       600
     tcaaaaatga agcagctgat tgtccaagga taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page