(data stored in ACNUC7421 zone)

EMBL: AL009126.HXLB

AL009126.HXLB        Location/Qualifiers
FT   CDS_pept        complement(374603..375160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxlB"
FT                   /locus_tag="BSU_03450"
FT                   /old_locus_tag="BSU03450"
FT                   /product="6-phospho-3-hexuloisomerase (PHI)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="5.3.1.27"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10572115, 15978081; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03450"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12139"
FT                   /db_xref="GOA:P42404"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017552"
FT                   /db_xref="PDB:1M3S"
FT                   /db_xref="PDB:1VIV"
FT                   /db_xref="SubtiList:BG11182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42404"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10572115, 15978081"
FT                   /protein_id="CAB12139.1"
FT                   /translation="MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAG
FT                   RSGLMAKSFAMRLMHMGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSL
FT                   HGIVAALTINPESSIGKQADLIIRMPGSPKDQSNGSYKTIQPMGSLFEQTLLLFYDAVI
FT                   LKLMEKKGLDSETMFTHHANLE"
     atgaaaacga ctgaatacgt agcggaaatt ctcaatgagt tacacaattc agcagcttat        60
     atttctaatg aagaagctga ccagcttgcc gatcacattc tttcatccca ccaaattttc       120
     accgcgggtg cggggcggtc tggcctgatg gcaaaatcct tcgcgatgag actgatgcac       180
     atgggcttca acgcccatat agtaggtgag attctcactc cgccgctcgc cgaaggagat       240
     ctagttatta tcggctcagg atcaggcgag acaaagagct tgattcatac cgcagcaaaa       300
     gcaaaaagct tacacggaat tgttgccgct ttaaccatca atccggaatc aagcatcgga       360
     aaacaagcgg acctcatcat cagaatgcct ggttccccta aagaccagtc taacggaagc       420
     tataaaacca ttcagccaat gggatcatta tttgaacaaa ctttgctgct cttctatgat       480
     gcagtgattt taaaactcat ggagaaaaaa ggtctcgatt ctgaaactat gttcactcac       540
     cacgcaaacc ttgaatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page