(data stored in ACNUC7421 zone)

EMBL: AL009126.ISPD

AL009126.ISPD        Location/Qualifiers
FT   CDS_pept        109789..110487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BSU_00900"
FT                   /old_locus_tag="BSU00900"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase, nonmevalonate isoprenoid pathway"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.7.60"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 15044829, 15379557,
FT                   16533036, 17081012, 17458547, 23840410, 27821871; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00900"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11866"
FT                   /db_xref="GOA:Q06755"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="PDB:5DDT"
FT                   /db_xref="PDB:5DDV"
FT                   /db_xref="PDB:5HS2"
FT                   /db_xref="SubtiList:BG10152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06755"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 15044829, 15379557, 16533036, 17081012,
FT                   17458547, 23840410, 27821871"
FT                   /protein_id="CAB11866.1"
FT                   /translation="MSYDVVIPAAGQGKRMKAGRNKLFIELKGDPVIIHTLRVFDSHRQ
FT                   CDKIILVINEQEREHFQQLLSDYPFQTSIELVAGGDERQHSVYKGLKAVKQEKIVLVHD
FT                   GARPFIKHEQIDELIAEAEQTGAAILAVPVKDTIKRVQDLQVSETIERSSLWAVQTPQA
FT                   FRLSLLMKAHAEAERKGFLGTDDASLVEQMEGGSVRVVEGSYTNIKLTTPDDLTSAEAI
FT                   MESESGNKHV"
     atgagttatg atgtggtgat tcctgcagcc ggacagggaa agcggatgaa ggcagggaga        60
     aataaactgt tcattgagct gaagggagac ccggtgatca tacacacgtt aagagtgttt       120
     gacagccacc ggcagtgcga taaaatcatt ttggtgatta acgagcagga gcgggagcac       180
     tttcagcaat tgctgtccga ttacccgttt caaacttcaa ttgagcttgt tgcaggcgga       240
     gatgagcgac agcacagtgt gtataagggg ctgaaagccg taaagcagga aaagattgtc       300
     cttgtacatg acggtgcccg tccatttata aaacatgaac aaattgacga actgatcgca       360
     gaggcggaac agacaggagc ggccatcctt gctgttccgg taaaagatac gattaaacgc       420
     gttcaagatt tacaagtcag tgagacgatt gaacgttcaa gcttgtgggc tgtccaaacg       480
     ccacaagctt ttcgtctttc tttattgatg aaggctcacg ctgaggccga gcgcaaggga       540
     tttttaggga cggatgacgc cagcctcgtt gaacagatgg agggcggttc ggtccgtgtt       600
     gtagaaggca gctatacaaa tattaagctg acgacgccag acgatttgac gtcagctgaa       660
     gctatcatgg aatcagaaag tgggaataaa catgtttag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page