(data stored in SCRATCH zone)

EMBL: AL009126.ISPE

AL009126.ISPE        Location/Qualifiers
FT   CDS_pept        53516..54385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BSU_00460"
FT                   /old_locus_tag="BSU00460"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.1.148"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 11361082, 12682299, 12771135,
FT                   17458547, 23840410; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11822"
FT                   /db_xref="GOA:P37550"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="SubtiList:BG10109"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37550"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11822.1"
FT                   /translation="MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTE
FT                   LAEDEVRVSSHNRFVPDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSS
FT                   DAAATLRGLNRLWNLNLSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPH
FT                   CWVILAKPTIGVSTAEVYRALKLDGIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTL
FT                   DMHPEVAMIKNQMKRFGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNALD"
     atgcgtattt tagaaaaagc gccagctaag atcaatctgt cacttgacgt cacccgaaaa        60
     cgcccggatg gctatcatga agtcgaaatg atcatgacga caattgattt agctgatcga       120
     attgaattga cggagcttgc agaggatgaa gtgagggttt cctcccacaa ccgatttgtg       180
     cctgatgacc aaagaaactt agcttatcag gctgccaagc tgatcaagga cagatacaac       240
     gtgaaaaagg gagtttccat catgattacg aaggtaattc cggtggctgc cggtcttgcc       300
     ggcggaagca gtgatgcggc ggcgacactc agagggctga acagactgtg gaatttaaat       360
     ctgtccgcgg aaacgcttgc tgagcttgga gcggaaattg gctctgacgt ttcattttgt       420
     gtctatggcg gaactgcatt agcaacaggg cgcggcgaga aaattaaaca tatcagcacg       480
     cctccgcact gctgggtcat tttagcgaag ccgacaatcg gtgtttcaac tgctgaagtg       540
     tacagagcgc tgaaactgga tggtatagag catcccgatg tacaaggcat gatcgaggcg       600
     atagaagaaa agagttttca gaagatgtgc agccggttag gcaatgtgct tgaatctgtt       660
     acactcgata tgcatcctga agttgcgatg atcaaaaacc agatgaaacg ctttggtgca       720
     gatgccgtgt taatgagcgg gagcggcccg acagtgtttg gactggttca gtatgagtcg       780
     aaggtgcaga gaatttataa cgggttaaga ggcttctgcg atcaagttta tgcggtgaga       840
     atgatcggcg aacagaacgc tcttgattaa                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page