(data stored in SCRATCH zone)

EMBL: AL009126.ISPF

AL009126.ISPF        Location/Qualifiers
FT   CDS_pept        110480..110956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BSU_00910"
FT                   /old_locus_tag="BSU00910"
FT                   /product="2-C-methyl-D-erythritol-2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.6.1.12"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9622350, 11997478, 12270818,
FT                   12682299, 17458547, 23840410; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00910"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11867"
FT                   /db_xref="GOA:Q06756"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="PDB:5IWX"
FT                   /db_xref="PDB:5IWY"
FT                   /db_xref="SubtiList:BG10153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06756"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9622350, 11997478, 12270818, 12682299, 17458547,
FT                   23840410"
FT                   /protein_id="CAB11867.1"
FT                   /translation="MFRIGQGFDVHQLVEGRPLIIGGIEIPYEKGLLGHSDADVLLHTV
FT                   ADACLGAVGEGDIGKHFPDTDPEFKDADSFKLLQHVWGIVKQKGYVLGNIDCTIIAQKP
FT                   KMLPYIEDMRKRIAEGLEADVSQVNVKATTTEKLGFTGRAEGIAAQATVLIQKG"
     atgtttagaa ttggacaagg atttgatgtg catcaattag tggagggccg tcctctcatt        60
     attggcggaa ttgaaatccc gtacgaaaaa gggctgcttg gccattctga tgcagacgta       120
     ttgttgcata ccgtcgctga cgcctgcctg ggagctgtgg gtgaaggaga cataggcaag       180
     cattttcctg acacagatcc cgagttcaag gacgcagatt ctttcaaatt acttcagcat       240
     gtctggggaa tcgtgaaaca gaaggggtat gtccttggga acattgattg caccatcata       300
     gcgcaaaagc cgaagatgct gccgtacata gaagatatga gaaaaagaat tgctgaaggc       360
     cttgaggcag atgtttctca agtaaatgta aaagcaacaa cgacagaaaa gcttggattt       420
     acaggccggg cggaaggaat agcggctcag gcgacagtac tgatacaaaa aggctaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page