(data stored in ACNUC7421 zone)

EMBL: AL009126.KBAA

AL009126.KBAA        Location/Qualifiers
FT   CDS_pept        159182..159778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BSU_01560"
FT                   /old_locus_tag="BSU01560"
FT                   /product="inner membrane protein involved in activation of
FT                   the KinB signaling pathway to sporulation"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8576055, 15849754, 16850406;
FT                   Product type r: regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01560"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11932"
FT                   /db_xref="GOA:P16449"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="SubtiList:BG10643"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16449"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8576055, 15849754, 16850406"
FT                   /protein_id="CAB11932.1"
FT                   /translation="MKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFEAGQI
FT                   FSVLFWFIGVGMIFSVISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMY
FT                   VRFLFFGESGESLAGYAWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWF
FT                   PALRVNDEDWLYLMLFPLMACNAFQLLMLPKFAAK"
     atgaaaagcc gtggtttagt tcgttttttc ttttctattt tagctgtcgg ggcgcttatc        60
     acgagtattg tgggttttgc tttaaagtgg ggagaatata gagggctgtt tctaacattt       120
     gaagcgggac agattttctc tgttttattt tggtttatcg gtgtaggcat gattttcagt       180
     gtgatcagcc aaatgggttt tttcgtgttt ttaacagttc atcggtttgc gcttgagata       240
     ttaaggtcct cctctttgtg gaatttgctg cagttgtttt tcatcctgtt tgttgctttt       300
     gatttaatgt acgtgcgttt tttatttttt ggagagagcg gagaatcgct ggctggctat       360
     gcgtggttac cggtgttttt attgatcttt ggagtgatta cagcttatat aaagcaaaag       420
     cagtcctcta agaaaacatt tgtgtcatcg ttatttttga tggttgtgat taccgcatta       480
     gaatggttcc ctgcattaag agtaaatgat gaggactggc tttatttaat gctttttccg       540
     ttaatggcat gtaatgcctt ccaattgctg atgctgccga agtttgcagc aaagtaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page