(data stored in SCRATCH zone)

EMBL: AL009126.KDGD

AL009126.KDGD        Location/Qualifiers
FT   CDS_pept        267890..268816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgD"
FT                   /locus_tag="BSU_02460"
FT                   /old_locus_tag="BSU02460"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.41"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 12044674; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02460"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12040"
FT                   /db_xref="GOA:P42235"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="SubtiList:BG11158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42235"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12040.2"
FT                   /translation="MSRIRKAPAGILGFPVAPFNTQGKLEEEALFQNIEFLLNEGLEAI
FT                   FIACGSGEFQSLSQKEYEQMVEVAVSAAGGKVPVYTGVGGNLSTALDWAQLSEKKGADG
FT                   YLILPPYLVHGEQEGLYQYAKTIIESTDLNAILYQRDNAVLSVEQIKRLTECEQLVGVK
FT                   DGVGNMDLNINLVYTIGDRLGWLNGMPMAEVTMPAYLPIGFHSYSSAISNYIPHISRMF
FT                   YDALKNGNDELVKELYRHVILPINDIRKQRKGYAVSLIKAGMEIMGLNVRNTARPPVGP
FT                   VEKDHYQQLEAILKQAADRFPKKAATV"
     atgagccgta tcagaaaagc acccgctgga attttaggtt ttccggttgc tccttttaac        60
     acacaaggaa aactggagga agaagctctt tttcaaaaca ttgagttttt gctgaatgag       120
     ggcttggaag cgatatttat cgcttgcggg tctggtgaat tccaatctct cagccagaag       180
     gaatatgagc aaatggtgga agtcgcagtc tcggcagccg gaggaaaggt gccggtctac       240
     acgggggtgg gcggcaacct cagcacagcg cttgattggg cgcagctgtc ggagaaaaaa       300
     ggcgccgacg gctacttgat tctgcctccg tatttggtgc atggcgaaca ggaggggctg       360
     taccagtatg cgaaaacgat tattgaaagc actgacttga acgcgattct ttatcagcgc       420
     gataacgcag ttctctctgt tgaacagatc aaacgtctga ccgaatgtga acagcttgtc       480
     ggtgtcaaag acggggtagg aaatatggat ttgaatatca atctcgtcta tacgatcggc       540
     gaccgcttgg gatggctcaa cggaatgccg atggctgaag tgacgatgcc ggcttatctg       600
     ccgatcgggt tccactctta ctcttcagcg atttcaaatt atatcccgca tatttcgcga       660
     atgttctatg atgcattgaa aaacggaaat gacgagcttg tgaaggaact ctatcggcat       720
     gtgattctgc cgatcaacga cattcgcaaa caacgaaaag gctacgccgt atccttgatt       780
     aaagccggta tggaaatcat gggtttgaat gtaaggaata cagccagacc gcctgtcggc       840
     ccggttgaaa aagatcatta tcagcaattg gaagcaattt tgaagcaggc ggctgaccgt       900
     tttccgaaaa aagccgcgac ggtttga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page