(data stored in ACNUC7421 zone)

EMBL: AL009126.LCTE

AL009126.LCTE        Location/Qualifiers
FT   CDS_pept        329774..330739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctE"
FT                   /locus_tag="BSU_03050"
FT                   /old_locus_tag="BSU03050"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.1.1.27"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10809684, 16207915, 19383131;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12099"
FT                   /db_xref="GOA:P13714"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3PQD"
FT                   /db_xref="PDB:3PQE"
FT                   /db_xref="PDB:3PQF"
FT                   /db_xref="SubtiList:BG19003"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13714"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10809684, 16207915, 19383131"
FT                   /protein_id="CAB12099.2"
FT                   /translation="MMNKHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAM
FT                   GDVMDLNHGKAFAPQPVKTSYGTYEDCKDADIVCICAGANQKPGETRLELVEKNLKIFK
FT                   GIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEY
FT                   FGAAPQNVHAHIIGEHGDTELPVWSHANVGGVPVSELVEKNDAYKQEELDQIVDDVKNA
FT                   AYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNR
FT                   GGIAGITELNLNEKEKEQFLHSAGVLKNILKPHFAEQKVN"
     atgatgaaca aacatgtaaa taaagtagct ttaatcggag cgggttttgt tggaagcagt        60
     tatgcatttg cgttaattaa ccaaggaatc acagatgagc ttgtggtcat tgatgtaaat       120
     aaagaaaaag caatgggcga tgtgatggat ttaaaccacg gaaaggcgtt tgcgccacaa       180
     ccggtcaaaa catcttacgg aacatatgaa gactgcaagg atgctgatat tgtctgcatt       240
     tgcgccggag caaaccaaaa acctggtgag acacgccttg aattagtaga aaagaacttg       300
     aagattttca aaggcatcgt tagtgaagtc atggcgagcg gatttgacgg cattttctta       360
     gtcgcgacaa atccggttga tatcctgact tacgcaacat ggaaattcag cggcctgcca       420
     aaagagcggg tgattggaag cggcacaaca cttgattctg cgagattccg tttcatgctg       480
     agcgaatact ttggcgcagc gcctcaaaac gtacacgcgc atattatcgg agagcacggc       540
     gacacagagc ttcctgtttg gagccacgcg aatgtcggcg gtgtgccggt cagtgaactc       600
     gttgagaaaa acgatgcgta caaacaagag gagctggacc aaattgtaga tgatgtgaaa       660
     aacgcagctt accatatcat tgagaaaaaa ggcgcgactt attatggggt tgcgatgagt       720
     cttgctcgca ttacaaaagc cattcttcat aatgaaaaca gcatattaac tgtcagcaca       780
     tatttggacg ggcaatacgg tgcagatgac gtgtacatcg gtgtgccggc tgtcgtgaat       840
     cgcggaggga tcgcaggtat cactgagctg aacttaaatg agaaagaaaa agaacagttc       900
     cttcacagcg ccggcgtcct taaaaacatt ttaaaacctc attttgcaga acaaaaagtc       960
     aactaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page