(data stored in ACNUC7421 zone)

EMBL: AL009126.LMRB

AL009126.LMRB        Location/Qualifiers
FT   CDS_pept        complement(288653..290092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmrB"
FT                   /locus_tag="BSU_02670"
FT                   /old_locus_tag="BSU02670"
FT                   /product="flavonoid efflux transporter; drug-export
FT                   protein"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 15317768, 15849754, 16850406,
FT                   17483215; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12061"
FT                   /db_xref="GOA:O35018"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="SubtiList:BG12613"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35018"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:15317768, 15849754, 16850406, 17483215"
FT                   /protein_id="CAB12061.1"
FT                   /translation="MILETTAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMK
FT                   ELNITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIAALAPS
FT                   FSFLLAARIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGL
FT                   VLEHLNWHWIFWISLPFLVLALVFGIAYMQNVSETTKPKIDVLSIILSTIGFGGIVFGF
FT                   SNAGEGSGGWSSPTVIVSLIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVF
FT                   ICMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYGPKWLV
FT                   IPGFVIVTVVLWFFSNVTTTSTAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPD
FT                   GTAIMNTLQQMAGAIGTAVAVSIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFA
FT                   MIVAIIGLIGAFFMKRVKVDH"
     atgattttgg aaacaacagc taaagcatct cagcaataca aagtgatgcc gattatgatt        60
     tccttgctgt tggccggttt tatcggcatg ttcagtgaaa cagcgctgaa tattgcgtta       120
     accgacctta tgaaggaatt gaacattaca gcggcaaccg tccaatggtt aacgacgggc       180
     tacctgcttg tactcggtat ccttgttcct gtttcaggac tgctgttgca gtggttcaca       240
     acaagacagc tttttaccgt gtcacttatc ttttcaattt taggtacatt cattgcggcg       300
     cttgcgccga gcttctcgtt tttattagcg gcaaggatcg ttcaggcact tggaaccggt       360
     cttttactgc cgctgatgtt taacacaatc ttggtgattt tcccgcctca taaacggggt       420
     gccgcaatgg gaacgatcgg gcttgtcatt atgttcgcgc ccgccatcgg cccaactttc       480
     tcaggattgg ttctggagca tctcaactgg cactggattt tctggatctc tcttccattc       540
     cttgtgctgg cgcttgtttt cggtatcgca tatatgcaaa atgtatctga aacgacaaag       600
     ccgaaaatcg atgtattgtc tatcatcctg tcgacgattg gcttcggcgg cattgtattc       660
     ggattcagca acgcgggtga aggctccggg ggatggtcca gcccgactgt tatcgtgtcg       720
     ctgattgtcg gcgttgtcgg ccttatctta ttttcaatcc gccagctgac aatgaagcag       780
     cctatgatga acctccgtgc gttcaaatac ccgatgttta ttttgggtgt gatcatggtg       840
     ttcatttgta tgatggtcat tctgtcatct atgctgcttc tgccgatgta tctgcaaggc       900
     ggcttagtcc tcactgcatt tgcatctggt cttgttctct tgccgggcgg tattttaaat       960
     ggatttatgt cccctgttac aggccgcttg ttcgataaat acgggccgaa atggcttgtc      1020
     attccgggat ttgtgattgt caccgttgta ctatggttct tctcaaatgt cacgaccact      1080
     tcaacagctg tgctgattat catcctgcac acctgcttga tgatcgggat ttctatgatc      1140
     atgatgcctg cacagacaaa cggtttaaac caactgccgc gtgaatttta tccagacggc      1200
     accgccatta tgaacacgct gcagcaaatg gccggcgcta tcggaacagc ggttgcggtc      1260
     agcattatgg ctgcaggcca gcatgattat atgagtacag ttaaaaaccc tgccgatccg      1320
     gcagtcatcc cgcaagcttt gacagcaggc gtacagcacg catttgtgtt tgcaatgatt      1380
     gttgccatta tcggtttaat tggcgctttc tttatgaaac gcgttaaagt agatcattaa      1440
//

If you have problems or comments...

PBIL Back to PBIL home page