(data stored in SCRATCH zone)

EMBL: AL009126.LYSS

AL009126.LYSS        Location/Qualifiers
FT   CDS_pept        88727..90226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BSU_00820"
FT                   /old_locus_tag="BSU00820"
FT                   /product="lysyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14623972, 20649968;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11858"
FT                   /db_xref="GOA:P37477"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="SubtiList:BG10144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37477"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14623972, 20649968"
FT                   /protein_id="CAB11858.1"
FT                   /translation="MSQEEHNHEELNDQLQVRRDKMNQLRDNGIDPFGARFERTHQSQE
FT                   VISAYQDLTKEELEEKAIEVTIAGRMMTKRGKGKAGFAHLQDLEGQIQIYVRKDSVGDD
FT                   QYEIFKSSDLGDLIGVTGKVFKTNVGELSVKATSFELLTKALRPLPDKYHGLKDVEQRY
FT                   RQRYLDLIVNPDSKHTFITRSKIIQAMRRYLDDHGYLEVETPTMHSIPGGASARPFITH
FT                   HNALDIPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMSLTENLVAHIAQEVLGTTTIQYGEEQIDLKPEWKRIHMVDAVKEATGVDFWEE
FT                   VTVEQAREYAKEHEVEIKDSMTVGHIINEFFEQKIEETLIQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREAGNDEAHLMDEDFVE
FT                   ALEYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPQMRQR"
     atgagtcaag aagagcataa ccatgaagaa ttgaatgatc agctgcaagt cagacgcgat        60
     aaaatgaatc agctgagaga taacggcatc gatccattcg gcgcacgttt tgaaagaact       120
     catcagtctc aagaagttat ttcggcatat caagatctaa ccaaagaaga gttagaagaa       180
     aaagcgattg aagttacaat cgcaggccgc atgatgacaa aacgcggcaa aggaaaagcc       240
     ggctttgccc atcttcagga tttagaaggc caaatccaaa tctacgtaag aaaagacagt       300
     gtcggtgacg accaatatga aatcttcaag tcttctgacc tcggtgatct tatcggcgta       360
     accggaaaag tcttcaaaac aaatgtaggc gaattgtctg ttaaagcaac ttcctttgaa       420
     ttgctgacaa aagcgcttcg tccgcttcct gacaaatacc atggtttaaa agacgttgag       480
     cagcgctacc gtcagcgcta tctggatctt atcgtaaacc cagacagcaa acatacgttc       540
     attacacgaa gcaagatcat tcaagctatg agaaggtacc ttgatgatca tggatactta       600
     gaagtagaaa cacctacaat gcacagcatt cctgggggag cttctgcacg tccgtttatc       660
     actcaccaca acgcgttaga cattccactc tatatgcgta ttgctatcga actgcaccta       720
     aaacgtctaa ttgtcggcgg tttagaaaaa gtatatgaaa tcggccgtgt tttccgtaac       780
     gaaggtgtct ctacacgcca taaccctgaa tttacaatga ttgagttata tgaagcatat       840
     gcggactata aagatatcat gagcttaact gaaaaccttg tcgctcatat cgcccaagaa       900
     gtgcttggca caactacgat tcaatacggg gaagagcaaa tcgaccttaa accggagtgg       960
     aaaagaatcc atatggttga cgcagtcaaa gaagcgaccg gcgttgattt ctgggaagag      1020
     gttactgttg agcaggcgcg tgaatatgca aaagaacatg aagtagaaat taaagactct      1080
     atgacagtag gccatatcat caacgaattc ttcgaacaaa aaattgaaga aacgcttatt      1140
     cagccaacgt ttatttacgg gcatcctgta gaaatttctc ctcttgctaa gaaaaaccct      1200
     gaggacccgc gttttacaga ccgttttgag ctgtttatcg ttggccgtga acatgccaac      1260
     gcgtttacag agctgaatga tcctattgat caaagagaac gctttgaagc gcaattaaaa      1320
     gagcgtgaag ccggtaatga tgaagctcat ttaatggatg aagactttgt tgaagctctg      1380
     gaatacggta tgccgccaac aggaggttta ggcatcggta tcgaccgtct ggttatgctg      1440
     ctgacgaatg ccccttctat tcgcgatgtg ctgttattcc cgcaaatgag acaacgctaa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page